Protein Family IF03398
Metagenome
Isolate
400
Members
106
Samples
375
Scaffolds
90.87
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11462894|Ga0123353_114628942
- Length
- 101 aa
- Sequence
- MSLAEMLEITTVILAYYSSFKRDYKRIKSRGYDMRRVDEVIDVLAHKQPLPQRYRDHQLVGEYIGCRECHIAPDWLLIYKIDNDELLLLLSRTGTHSDLF*
Sample Types
Isolate
6.2%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.9%
Unclassified
27.2%
Kalotermitidae
12.6%
Drosophilidae
5.8%
Formicidae
4.9%
Termopsidae
3.9%
Rhinotermitidae
2.9%
Culicidae
1.9%
Passalidae
1.0%
Calliphoridae
1.0%
Hodotermitidae
1.0%
Taxonomy
Archaea
1
Bacteria
366
Eukaryota
0
Viruses
0
Unclassified
33
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 2 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 3 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 4 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 9 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 10 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 13 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 14 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 15 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 16 | 2820058318 | Unclassified Proteobacteria Nt197P4bin33 | Isolate | Unclassified |
| 17 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 18 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 19 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 20 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 25 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 26 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 27 | 2820727601 | Unclassified Cloacimonetes Nt197P3bin46 | Isolate | Unclassified |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 30 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 36 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 41 | 3300007766 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 4 gut | Metagenome | Drosophilidae |
| 42 | 2820806175 | Unclassified Actinobacteria Th196P3bin122 | Isolate | Unclassified |
| 43 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 44 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 45 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 46 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 47 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 48 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 51 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 52 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 53 | 2820721785 | Unclassified Fibrobacteres Lab288P1bin58 | Isolate | Unclassified |
| 54 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 55 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 56 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 57 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 58 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 59 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 60 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 61 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 62 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 63 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 64 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 65 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 66 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 67 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 68 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 69 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 70 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 72 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 73 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 74 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 75 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 76 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 77 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 78 | 2820909719 | Unclassified Actinobacteria Emb289P4bin20 | Isolate | Unclassified |
| 79 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 80 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 81 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 82 | 2820582954 | Unclassified Firmicutes Emb289P3bin119 | Isolate | Unclassified |
| 83 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 84 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 85 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 86 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 87 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 88 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 89 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 90 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 91 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 92 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 93 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 94 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 95 | 3300005319 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut | Metagenome | Drosophilidae |
| 96 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 97 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 98 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 99 | 2820556368 | Unclassified Firmicutes Emb289P3bin92 | Isolate | Unclassified |
| 100 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 101 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 102 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 103 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 104 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 105 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 106 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_405509 | 3300042656 | Bacteria | 1563 |
| 2 | Ga0123355_10196908 | 3300009826 | Bacteria | 2953 |
| 3 | Ga0123355_11086879 | 3300009826 | Unclassified | 834 |
| 4 | Ga0123356_10346919 | 3300010049 | Bacteria | 1607 |
| 5 | Ga0123356_11245762 | 3300010049 | Bacteria | 909 |
| 6 | Ga0123356_12979319 | 3300010049 | Unclassified | 591 |
| 7 | Ga0123353_10096025 | 3300010167 | Bacteria | 4777 |
| 8 | Ga0123353_10690605 | 3300010167 | Bacteria | 1435 |
| 9 | Ga0123353_10948732 | 3300010167 | Bacteria | 1164 |
| 10 | Ga0123353_11304908 | 3300010167 | Bacteria | 942 |
| 11 | Ga0123353_11619912 | 3300010167 | Bacteria | 816 |
| 12 | Ga0123353_11750328 | 3300010167 | Bacteria | 775 |
| 13 | Ga0123353_13032687 | 3300010167 | Unclassified | 543 |
| 14 | Ga0123354_10083934 | 3300010882 | Unclassified | 4477 |
| 15 | Ga0466706_270065 | 3300042599 | Bacteria | 1802 |
| 16 | Ga0466717_040282 | 3300042604 | Bacteria | 2707 |
| 17 | Ga0466717_303375 | 3300042604 | Unclassified | 4993 |
| 18 | Ga0466720_118911 | 3300042607 | Bacteria | 1326 |
| 19 | Ga0466698_101609 | 3300042610 | Bacteria | 1955 |
| 20 | Ga0466698_305425 | 3300042610 | Bacteria | 1992 |
| 21 | Ga0466656_316440 | 3300042550 | Bacteria | 1197 |
| 22 | Ga0466693_139148 | 3300042592 | Bacteria | 4397 |
| 23 | Ga0466694_132103 | 3300042594 | Bacteria | 1367 |
| 24 | Ga0466696_468154 | 3300042596 | Bacteria | 7557 |
| 25 | Ga0466699_216268 | 3300042597 | Bacteria | 1328 |
| 26 | Ga0466699_288691 | 3300042597 | Bacteria | 1618 |
| 27 | JGI24696J40584_12748213 | 3300002834 | Bacteria | 791 |
| 28 | Ga0068302_10019279 | 3300005071 | Bacteria | 1087 |
| 29 | Ga0072941_1020353 | 3300005201 | Bacteria | 1160 |
| 30 | Ga0072941_1240729 | 3300005201 | Bacteria | 4687 |
| 31 | Ga0072941_1333256 | 3300005201 | Bacteria | 1452 |
| 32 | Ga0103266_1008011 | 3300007067 | Bacteria | 1282 |
| 33 | Ga0104041_1003674 | 3300007106 | Unclassified | 4509 |
| 34 | Ga0104042_1036493 | 3300007130 | Unclassified | 1146 |
| 35 | Ga0102740_1025655 | 3300007140 | Bacteria | 906 |
| 36 | Ga0466734_065494 | 3300042623 | Bacteria | 1824 |
| 37 | Ga0466708_455428 | 3300042652 | Bacteria | 24974 |
| 38 | Ga0466725_129010 | 3300042654 | Bacteria | 35765 |
| 39 | Ga0466710_441621 | 3300042613 | Bacteria | 2209 |
| 40 | Ga0466712_174351 | 3300042614 | Bacteria | 1296 |
| 41 | Ga0466715_418126 | 3300042616 | Bacteria | 1216 |
| 42 | Ga0466718_030985 | 3300042617 | Bacteria | 1794 |
| 43 | Ga0466718_042433 | 3300042617 | Bacteria | 2258 |
| 44 | Ga0466718_044995 | 3300042617 | Bacteria | 4939 |
| 45 | Ga0466718_052572 | 3300042617 | Bacteria | 2884 |
| 46 | Ga0466718_053441 | 3300042617 | Bacteria | 1137 |
| 47 | Ga0466726_163797 | 3300042619 | Bacteria | 1646 |
| 48 | Ga0466729_053308 | 3300042621 | Bacteria | 3119 |
| 49 | Ga0466733_003448 | 3300042659 | Bacteria | 4541 |
| 50 | Ga0123357_10225686 | 3300009784 | Bacteria | 2066 |
| 51 | Ga0123357_10252835 | 3300009784 | Bacteria | 1881 |
| 52 | Ga0123355_10316083 | 3300009826 | Unclassified | 2110 |
| 53 | Ga0123356_10150876 | 3300010049 | Bacteria | 2307 |
| 54 | Ga0123356_12050767 | 3300010049 | Bacteria | 714 |
| 55 | Ga0123356_13036934 | 3300010049 | Bacteria | 586 |
| 56 | Ga0123353_10008858 | 3300010167 | Bacteria | 13800 |
| 57 | Ga0123353_10153938 | 3300010167 | Bacteria | 3668 |
| 58 | Ga0123353_10159339 | 3300010167 | Bacteria | 3594 |
| 59 | Ga0123353_11503955 | 3300010167 | Bacteria | 857 |
| 60 | Ga0123354_10163920 | 3300010882 | Bacteria | 2623 |
| 61 | Ga0123354_10523596 | 3300010882 | Bacteria | 910 |
| 62 | Ga0123354_10549313 | 3300010882 | Bacteria | 872 |
| 63 | Ga0466706_135192 | 3300042599 | Bacteria | 1662 |
| 64 | Ga0466700_042863 | 3300042600 | Bacteria | 3647 |
| 65 | Ga0466707_034346 | 3300042601 | Bacteria | 62797 |
| 66 | Ga0466714_049354 | 3300042603 | Bacteria | 1931 |
| 67 | Ga0466717_279851 | 3300042604 | Bacteria | 1314 |
| 68 | Ga0466720_090841 | 3300042607 | Bacteria | 1173 |
| 69 | Ga0466722_224299 | 3300042609 | Bacteria | 2962 |
| 70 | Ga0466698_280460 | 3300042610 | Bacteria | 1840 |
| 71 | Ga0264413_117740 | 3300024493 | Bacteria | 1425 |
| 72 | Ga0415639_015578 | 3300038395 | Bacteria | 2500 |
| 73 | Ga0466693_036080 | 3300042592 | Bacteria | 2679 |
| 74 | Ga0466694_011674 | 3300042594 | Bacteria | 2542 |
| 75 | Ga0466695_104084 | 3300042595 | Bacteria | 1876 |
| 76 | Ga0466695_292890 | 3300042595 | Bacteria | 1060 |
| 77 | Ga0466699_070777 | 3300042597 | Bacteria | 1123 |
| 78 | Ga0466699_092288 | 3300042597 | Bacteria | 6607 |
| 79 | Ga0466699_311982 | 3300042597 | Bacteria | 3329 |
| 80 | Ga0466699_351347 | 3300042597 | Bacteria | 1447 |
| 81 | IMNBL1DRAFT_c0013400 | 3300000062 | Bacteria | 3680 |
| 82 | JGI24698J34947_10092735 | 3300002449 | Unclassified | 1380 |
| 83 | JGI24705J35276_12155375 | 3300002504 | Bacteria | 1204 |
| 84 | JGI24696J40584_12819786 | 3300002834 | Bacteria | 905 |
| 85 | Ga0068305_10388541 | 3300005083 | Bacteria | 2137 |
| 86 | Ga0072941_1014491 | 3300005201 | Bacteria | 1327 |
| 87 | Ga0103265_1005361 | 3300007068 | Bacteria | 1779 |
| 88 | Ga0466702_141658 | 3300042635 | Bacteria | 1847 |
| 89 | Ga0466702_181076 | 3300042635 | Bacteria | 1123 |
| 90 | Ga0466712_082044 | 3300042614 | Bacteria | 2487 |
| 91 | Ga0466718_004446 | 3300042617 | Bacteria | 1345 |
| 92 | Ga0466718_037092 | 3300042617 | Bacteria | 1342 |
| 93 | Ga0466697_114812 | 3300042611 | Bacteria | 2168 |
| 94 | Ga0466705_074338 | 3300042612 | Bacteria | 7292 |
| 95 | Ga0466733_199829 | 3300042659 | Bacteria | 2458 |
| 96 | Ga0123357_10715408 | 3300009784 | Bacteria | 711 |
| 97 | Ga0123355_10205952 | 3300009826 | Bacteria | 2862 |
| 98 | Ga0123355_10695155 | 3300009826 | Bacteria | 1170 |
| 99 | Ga0123356_10624954 | 3300010049 | Bacteria | 1243 |
| 100 | Ga0123356_10897050 | 3300010049 | Bacteria | 1058 |
| 101 | Ga0123356_11243988 | 3300010049 | Bacteria | 909 |
| 102 | Ga0123356_11572285 | 3300010049 | Bacteria | 813 |
| 103 | Ga0123353_10422992 | 3300010167 | Bacteria | 1973 |
| 104 | Ga0123353_10499696 | 3300010167 | Unclassified | 1773 |
| 105 | Ga0123353_10751896 | 3300010167 | Bacteria | 1357 |
| 106 | Ga0123353_10938373 | 3300010167 | Bacteria | 1172 |
| 107 | Ga0123353_11646472 | 3300010167 | Bacteria | 807 |
| 108 | Ga0123354_10264254 | 3300010882 | Bacteria | 1710 |
| 109 | Ga0466706_020914 | 3300042599 | Bacteria | 10941 |
| 110 | Ga0466706_199467 | 3300042599 | Bacteria | 1005 |
| 111 | Ga0466707_106508 | 3300042601 | Bacteria | 12251 |
| 112 | Ga0466714_093063 | 3300042603 | Bacteria | 1493 |
| 113 | Ga0466722_027670 | 3300042609 | Bacteria | 1476 |
| 114 | Ga0466698_344073 | 3300042610 | Bacteria | 5886 |
| 115 | Ga0415639_052096 | 3300038395 | Bacteria | 2225 |
| 116 | Ga0466656_362676 | 3300042550 | Bacteria | 1748 |
| 117 | Ga0466694_145860 | 3300042594 | Bacteria | 1100 |
| 118 | Ga0466699_309621 | 3300042597 | Bacteria | 1326 |
| 119 | Ga0466699_328400 | 3300042597 | Bacteria | 1582 |
| 120 | FAAS_10675466 | 3300001880 | Bacteria | 536 |
| 121 | FAAS_10809992 | 3300001880 | Bacteria | 527 |
| 122 | JGI24698J34947_10010790 | 3300002449 | Bacteria | 5014 |
| 123 | JGI24705J35276_12229175 | 3300002504 | Bacteria | 3336 |
| 124 | JGI24700J35501_10930747 | 3300002508 | Bacteria | 21558 |
| 125 | Ga0068305_10109242 | 3300005083 | Bacteria | 4921 |
| 126 | Ga0072941_1001253 | 3300005201 | Bacteria | 34161 |
| 127 | Ga0072941_1015147 | 3300005201 | Bacteria | 9001 |
| 128 | Ga0072941_1032051 | 3300005201 | Bacteria | 745 |
| 129 | Ga0072941_1057846 | 3300005201 | Bacteria | 2872 |
| 130 | Ga0072941_1134134 | 3300005201 | Bacteria | 747 |
| 131 | Ga0072941_1213821 | 3300005201 | Bacteria | 604 |
| 132 | Ga0074304_1000951 | 3300005319 | Bacteria | 3412 |
| 133 | Ga0104048_1003700 | 3300007143 | Unclassified | 2983 |
| 134 | Ga0105003_1004146 | 3300007766 | Bacteria | 18179 |
| 135 | Ga0466735_048998 | 3300042624 | Unclassified | 1175 |
| 136 | Ga0466708_287129 | 3300042652 | Unclassified | 1722 |
| 137 | Ga0466727_055917 | 3300042655 | Bacteria | 3006 |
| 138 | Ga0466712_068008 | 3300042614 | Bacteria | 4621 |
| 139 | Ga0466711_029407 | 3300042615 | Bacteria | 7830 |
| 140 | Ga0466718_109466 | 3300042617 | Bacteria | 2630 |
| 141 | Ga0466726_216563 | 3300042619 | Unclassified | 1095 |
| 142 | Ga0466732_314578 | 3300042656 | Bacteria | 1359 |
| 143 | Ga0466733_035750 | 3300042659 | Bacteria | 1115 |
| 144 | Ga0123357_10493262 | 3300009784 | Bacteria | 1024 |
| 145 | Ga0123355_10362782 | 3300009826 | Bacteria | 1906 |
| 146 | Ga0123355_10464152 | 3300009826 | Bacteria | 1587 |
| 147 | Ga0123355_11188797 | 3300009826 | Bacteria | 780 |
| 148 | Ga0123355_11226989 | 3300009826 | Bacteria | 762 |
| 149 | Ga0123355_11407599 | 3300009826 | Bacteria | 689 |
| 150 | Ga0123355_11414849 | 3300009826 | Bacteria | 686 |
| 151 | Ga0123355_11865258 | 3300009826 | Unclassified | 564 |
| 152 | Ga0123356_10338589 | 3300010049 | Bacteria | 1624 |
| 153 | Ga0123356_10484773 | 3300010049 | Bacteria | 1390 |
| 154 | Ga0123356_10963891 | 3300010049 | Bacteria | 1023 |
| 155 | Ga0123356_10973180 | 3300010049 | Bacteria | 1019 |
| 156 | Ga0123356_12366627 | 3300010049 | Bacteria | 664 |
| 157 | Ga0123356_12536205 | 3300010049 | Bacteria | 642 |
| 158 | Ga0123356_13066014 | 3300010049 | Unclassified | 583 |
| 159 | Ga0123356_13669395 | 3300010049 | Bacteria | 531 |
| 160 | Ga0123353_11872921 | 3300010167 | Bacteria | 741 |
| 161 | Ga0466706_075047 | 3300042599 | Bacteria | 14421 |
| 162 | Ga0466706_249110 | 3300042599 | Bacteria | 5973 |
| 163 | Ga0466707_023796 | 3300042601 | Unclassified | 1588 |
| 164 | Ga0466707_259614 | 3300042601 | Bacteria | 37252 |
| 165 | Ga0466719_013597 | 3300042606 | Bacteria | 3578 |
| 166 | Ga0466694_204711 | 3300042594 | Unclassified | 8693 |
| 167 | Ga0466695_029805 | 3300042595 | Bacteria | 1899 |
| 168 | JGI24698J34947_10195946 | 3300002449 | Bacteria | 795 |
| 169 | JGI24702J35022_10037754 | 3300002462 | Bacteria | 2580 |
| 170 | JGI24705J35276_12150200 | 3300002504 | Unclassified | 1180 |
| 171 | JGI24705J35276_12224099 | 3300002504 | Bacteria | 2576 |
| 172 | JGI24705J35276_12235203 | 3300002504 | Bacteria | 6296 |
| 173 | Ga0072941_1027799 | 3300005201 | Bacteria | 10972 |
| 174 | Ga0072941_1034678 | 3300005201 | Bacteria | 8040 |
| 175 | Ga0104147_1041816 | 3300007224 | Bacteria | 14491 |
| 176 | Ga0466729_236187 | 3300042621 | Bacteria | 1606 |
| 177 | Ga0466703_394700 | 3300042636 | Bacteria | 1654 |
| 178 | Ga0466709_005903 | 3300042648 | Bacteria | 2677 |
| 179 | Ga0466725_311995 | 3300042654 | Bacteria | 5506 |
| 180 | Ga0466727_336288 | 3300042655 | Bacteria | 1037 |
| 181 | Ga0466712_089981 | 3300042614 | Bacteria | 6669 |
| 182 | Ga0466712_146546 | 3300042614 | Bacteria | 5357 |
| 183 | Ga0466715_534637 | 3300042616 | Bacteria | 1431 |
| 184 | Ga0466718_146755 | 3300042617 | Bacteria | 2469 |
| 185 | Ga0466728_393692 | 3300042620 | Bacteria | 2022 |
| 186 | Ga0466728_482595 | 3300042620 | Bacteria | 1663 |
| 187 | Ga0466729_167111 | 3300042621 | Bacteria | 1504 |
| 188 | Ga0466729_179065 | 3300042621 | Bacteria | 1574 |
| 189 | Ga0466733_071636 | 3300042659 | Bacteria | 9145 |
| 190 | Ga0123357_10551903 | 3300009784 | Bacteria | 918 |
| 191 | Ga0123355_10085307 | 3300009826 | Bacteria | 5026 |
| 192 | Ga0123356_10001631 | 3300010049 | Bacteria | 24630 |
| 193 | Ga0123356_10019394 | 3300010049 | Bacteria | 6446 |
| 194 | Ga0123356_10049215 | 3300010049 | Bacteria | 3923 |
| 195 | Ga0123356_10123393 | 3300010049 | Bacteria | 2524 |
| 196 | Ga0123356_10183801 | 3300010049 | Bacteria | 2115 |
| 197 | Ga0123356_10312164 | 3300010049 | Bacteria | 1682 |
| 198 | Ga0123356_10422763 | 3300010049 | Bacteria | 1475 |
| 199 | Ga0123356_13489481 | 3300010049 | Bacteria | 545 |
| 200 | Ga0123353_10190501 | 3300010167 | Bacteria | 3238 |
| 201 | Ga0123353_10845149 | 3300010167 | Bacteria | 1256 |
| 202 | Ga0123353_11128986 | 3300010167 | Bacteria | 1037 |
| 203 | Ga0123353_11444915 | 3300010167 | Bacteria | 880 |
| 204 | Ga0123353_12593015 | 3300010167 | Bacteria | 600 |
| 205 | Ga0123354_10140523 | 3300010882 | Bacteria | 2990 |
| 206 | Ga0123354_10287615 | 3300010882 | Bacteria | 1582 |
| 207 | Ga0466716_463518 | 3300042605 | Bacteria | 1958 |
| 208 | Ga0466721_278177 | 3300042608 | Unclassified | 1246 |
| 209 | Ga0466698_083580 | 3300042610 | Bacteria | 1071 |
| 210 | Ga0466698_142013 | 3300042610 | Unclassified | 2355 |
| 211 | Ga0466698_358561 | 3300042610 | Bacteria | 1154 |
| 212 | Ga0264413_103538 | 3300024493 | Bacteria | 12300 |
| 213 | Ga0415639_043343 | 3300038395 | Unclassified | 3124 |
| 214 | Ga0466694_040155 | 3300042594 | Bacteria | 7812 |
| 215 | Ga0466699_006327 | 3300042597 | Bacteria | 2487 |
| 216 | Ga0466699_144902 | 3300042597 | Bacteria | 1006 |
| 217 | Ga0466699_237688 | 3300042597 | Bacteria | 2403 |
| 218 | IMNBL1DRAFT_c0001102 | 3300000062 | Bacteria | 20708 |
| 219 | FAAS_10722606 | 3300001880 | Unclassified | 527 |
| 220 | JGI24698J34947_10007521 | 3300002449 | Bacteria | 5986 |
| 221 | JGI24698J34947_10044348 | 3300002449 | Bacteria | 2277 |
| 222 | JGI24698J34947_10129080 | 3300002449 | Bacteria | 1084 |
| 223 | JGI24698J34947_10243614 | 3300002449 | Bacteria | 676 |
| 224 | JGI24703J35330_11697046 | 3300002501 | Bacteria | 1977 |
| 225 | Ga0068305_10218290 | 3300005083 | Bacteria | 867 |
| 226 | Ga0072940_1002368 | 3300005200 | Bacteria | 2564 |
| 227 | Ga0072940_1371531 | 3300005200 | Bacteria | 747 |
| 228 | Ga0072941_1008541 | 3300005201 | Bacteria | 40962 |
| 229 | Ga0104041_1003561 | 3300007106 | Unclassified | 3476 |
| 230 | Ga0123357_10000048 | 3300009784 | Bacteria | 99672 |
| 231 | Ga0466734_088573 | 3300042623 | Bacteria | 2108 |
| 232 | Ga0466702_163920 | 3300042635 | Bacteria | 1044 |
| 233 | Ga0466703_150161 | 3300042636 | Bacteria | 6902 |
| 234 | Ga0466704_559344 | 3300042643 | Bacteria | 2446 |
| 235 | Ga0466712_109952 | 3300042614 | Bacteria | 6574 |
| 236 | Ga0466712_277899 | 3300042614 | Bacteria | 2750 |
| 237 | Ga0466711_508665 | 3300042615 | Bacteria | 3515 |
| 238 | Ga0466718_021147 | 3300042617 | Bacteria | 1353 |
| 239 | Ga0466718_108881 | 3300042617 | Bacteria | 14071 |
| 240 | Ga0466726_310669 | 3300042619 | Bacteria | 1100 |
| 241 | Ga0466732_069026 | 3300042656 | Bacteria | 1301 |
| 242 | Ga0466732_105839 | 3300042656 | Bacteria | 2329 |
| 243 | Ga0466733_121390 | 3300042659 | Bacteria | 1539 |
| 244 | Ga0123357_10029014 | 3300009784 | Bacteria | 7500 |
| 245 | Ga0123357_10197050 | 3300009784 | Bacteria | 2303 |
| 246 | Ga0123357_10328829 | 3300009784 | Bacteria | 1497 |
| 247 | Ga0123353_12004467 | 3300010167 | Bacteria | 709 |
| 248 | Ga0123354_10056513 | 3300010882 | Bacteria | 5859 |
| 249 | Ga0466707_340906 | 3300042601 | Bacteria | 4178 |
| 250 | Ga0466713_049912 | 3300042602 | Bacteria | 13925 |
| 251 | Ga0466717_232184 | 3300042604 | Unclassified | 1234 |
| 252 | Ga0466722_039819 | 3300042609 | Bacteria | 3997 |
| 253 | Ga0466722_111833 | 3300042609 | Bacteria | 2524 |
| 254 | Ga0466722_222507 | 3300042609 | Bacteria | 3185 |
| 255 | Ga0160458_100115 | 3300012832 | Bacteria | 80119 |
| 256 | Ga0160460_100032 | 3300012845 | Bacteria | 316932 |
| 257 | Ga0466694_025701 | 3300042594 | Bacteria | 12708 |
| 258 | Ga0466694_284559 | 3300042594 | Bacteria | 3206 |
| 259 | Ga0466699_266118 | 3300042597 | Bacteria | 4740 |
| 260 | AustNasuHG_c1026825 | 3300000089 | Bacteria | 1784 |
| 261 | JGI24698J34947_10099085 | 3300002449 | Unclassified | 1315 |
| 262 | JGI24698J34947_10134201 | 3300002449 | Bacteria | 1053 |
| 263 | JGI24702J35022_10169171 | 3300002462 | Bacteria | 1235 |
| 264 | JGI24703J35330_11748873 | 3300002501 | Bacteria | 177009 |
| 265 | JGI24697J35500_11169505 | 3300002507 | Bacteria | 1447 |
| 266 | Ga0072940_1176654 | 3300005200 | Bacteria | 913 |
| 267 | Ga0072941_1009197 | 3300005201 | Bacteria | 876 |
| 268 | Ga0072941_1014325 | 3300005201 | Bacteria | 4496 |
| 269 | Ga0102737_1002087 | 3300007142 | Bacteria | 5124 |
| 270 | Ga0466703_279705 | 3300042636 | Bacteria | 1479 |
| 271 | Ga0466703_291151 | 3300042636 | Bacteria | 2451 |
| 272 | Ga0466709_132539 | 3300042648 | Bacteria | 20797 |
| 273 | Ga0466712_240593 | 3300042614 | Bacteria | 2789 |
| 274 | Ga0466712_251453 | 3300042614 | Bacteria | 1077 |
| 275 | Ga0466718_120862 | 3300042617 | Bacteria | 1597 |
| 276 | Ga0466718_131796 | 3300042617 | Bacteria | 1639 |
| 277 | Ga0466697_147374 | 3300042611 | Bacteria | 13152 |
| 278 | Ga0466732_226890 | 3300042656 | Bacteria | 1638 |
| 279 | Ga0123355_10001055 | 3300009826 | Bacteria | 38161 |
| 280 | Ga0123355_10151395 | 3300009826 | Bacteria | 3523 |
| 281 | Ga0123355_10223486 | 3300009826 | Bacteria | 2703 |
| 282 | Ga0123355_11088716 | 3300009826 | Bacteria | 833 |
| 283 | Ga0123356_10106241 | 3300010049 | Bacteria | 2703 |
| 284 | Ga0123356_11803433 | 3300010049 | Bacteria | 761 |
| 285 | Ga0123356_13023190 | 3300010049 | Bacteria | 587 |
| 286 | Ga0123356_13059039 | 3300010049 | Bacteria | 583 |
| 287 | Ga0123356_13080638 | 3300010049 | Bacteria | 581 |
| 288 | Ga0123353_10089803 | 3300010167 | Bacteria | 4948 |
| 289 | Ga0123353_10144120 | 3300010167 | Bacteria | 3811 |
| 290 | Ga0123353_11462894 | 3300010167 | Bacteria | 873 |
| 291 | Ga0123353_11517970 | 3300010167 | Bacteria | 852 |
| 292 | Ga0123354_10489712 | 3300010882 | Bacteria | 966 |
| 293 | Ga0466707_192280 | 3300042601 | Bacteria | 3853 |
| 294 | Ga0466714_078702 | 3300042603 | Bacteria | 1523 |
| 295 | Ga0466719_388329 | 3300042606 | Bacteria | 1182 |
| 296 | Ga0466698_057588 | 3300042610 | Bacteria | 1632 |
| 297 | Ga0264413_100161 | 3300024493 | Bacteria | 16833 |
| 298 | Ga0415639_013039 | 3300038395 | Bacteria | 2778 |
| 299 | Ga0466692_083860 | 3300042591 | Bacteria | 2974 |
| 300 | Ga0466693_366807 | 3300042592 | Bacteria | 1659 |
| 301 | Ga0466694_002091 | 3300042594 | Bacteria | 4046 |
| 302 | Ga0466694_034901 | 3300042594 | Bacteria | 2402 |
| 303 | Ga0466694_044555 | 3300042594 | Bacteria | 3652 |
| 304 | Ga0466694_226481 | 3300042594 | Bacteria | 5450 |
| 305 | Ga0466699_426009 | 3300042597 | Bacteria | 1119 |
| 306 | FAAS_10458353 | 3300001880 | Bacteria | 544 |
| 307 | JGI24698J34947_10024137 | 3300002449 | Bacteria | 3248 |
| 308 | JGI24695J34938_10060632 | 3300002450 | Bacteria | 1613 |
| 309 | Ga0072941_1032052 | 3300005201 | Bacteria | 9626 |
| 310 | Ga0104041_1128315 | 3300007106 | Bacteria | 789 |
| 311 | Ga0466734_155473 | 3300042623 | Archaea | 9604 |
| 312 | Ga0466704_346107 | 3300042643 | Bacteria | 18265 |
| 313 | Ga0466704_601355 | 3300042643 | Unclassified | 1304 |
| 314 | Ga0466709_182720 | 3300042648 | Bacteria | 1610 |
| 315 | Ga0466705_454477 | 3300042612 | Bacteria | 14187 |
| 316 | Ga0466712_289449 | 3300042614 | Bacteria | 4036 |
| 317 | Ga0466712_307778 | 3300042614 | Bacteria | 1516 |
| 318 | Ga0466718_020882 | 3300042617 | Bacteria | 1213 |
| 319 | Ga0466723_046648 | 3300042618 | Bacteria | 17305 |
| 320 | Ga0466732_322403 | 3300042656 | Bacteria | 1023 |
| 321 | Ga0466733_034561 | 3300042659 | Bacteria | 83410 |
| 322 | Ga0123357_10023973 | 3300009784 | Bacteria | 8207 |
| 323 | Ga0123357_10741036 | 3300009784 | Bacteria | 687 |
| 324 | Ga0123355_10000067 | 3300009826 | Bacteria | 112202 |
| 325 | Ga0123355_10014865 | 3300009826 | Bacteria | 12190 |
| 326 | Ga0123355_10076033 | 3300009826 | Bacteria | 5372 |
| 327 | Ga0123355_10237066 | 3300009826 | Unclassified | 2593 |
| 328 | Ga0123355_11216458 | 3300009826 | Bacteria | 767 |
| 329 | Ga0123356_10001185 | 3300010049 | Bacteria | 28884 |
| 330 | Ga0123356_10008537 | 3300010049 | Bacteria | 10176 |
| 331 | Ga0123356_10210396 | 3300010049 | Bacteria | 1993 |
| 332 | Ga0123356_10246955 | 3300010049 | Bacteria | 1860 |
| 333 | Ga0123356_10326460 | 3300010049 | Bacteria | 1650 |
| 334 | Ga0123353_10234318 | 3300010167 | Bacteria | 2859 |
| 335 | Ga0123353_10272918 | 3300010167 | Bacteria | 2604 |
| 336 | Ga0466701_028917 | 3300042598 | Bacteria | 1256 |
| 337 | Ga0466707_228794 | 3300042601 | Bacteria | 1669 |
| 338 | Ga0466707_285977 | 3300042601 | Bacteria | 27691 |
| 339 | Ga0466717_120067 | 3300042604 | Bacteria | 1114 |
| 340 | Ga0466716_503070 | 3300042605 | Bacteria | 1003 |
| 341 | Ga0466720_009168 | 3300042607 | Bacteria | 7905 |
| 342 | Ga0466698_418253 | 3300042610 | Bacteria | 1293 |
| 343 | Ga0264413_154026 | 3300024493 | Bacteria | 1048 |
| 344 | Ga0415639_000657 | 3300038395 | Bacteria | 1545 |
| 345 | Ga0415639_191968 | 3300038395 | Unclassified | 2348 |
| 346 | Ga0466692_191766 | 3300042591 | Bacteria | 55117 |
| 347 | Ga0466691_199671 | 3300042593 | Bacteria | 1592 |
| 348 | Ga0466694_107305 | 3300042594 | Bacteria | 23246 |
| 349 | Ga0466694_118387 | 3300042594 | Bacteria | 1259 |
| 350 | Ga0466695_102494 | 3300042595 | Bacteria | 4927 |
| 351 | Ga0466695_134492 | 3300042595 | Bacteria | 7691 |
| 352 | Ga0466696_187139 | 3300042596 | Bacteria | 18402 |
| 353 | Ga0466699_046365 | 3300042597 | Bacteria | 1160 |
| 354 | IMNBL1DRAFT_c0060275 | 3300000062 | Unclassified | 1144 |
| 355 | AustNasuHG_c1001209 | 3300000089 | Bacteria | 9302 |
| 356 | JGI24698J34947_10121742 | 3300002449 | Bacteria | 1131 |
| 357 | JGI24698J34947_10139593 | 3300002449 | Bacteria | 1023 |
| 358 | JGI24698J34947_10147384 | 3300002449 | Bacteria | 982 |
| 359 | JGI24695J34938_10001455 | 3300002450 | Bacteria | 20027 |
| 360 | JGI24702J35022_10198896 | 3300002462 | Bacteria | 1146 |
| 361 | JGI24705J35276_12126292 | 3300002504 | Bacteria | 1089 |
| 362 | JGI24705J35276_12227794 | 3300002504 | Bacteria | 3065 |
| 363 | JGI24705J35276_12237891 | 3300002504 | Unclassified | 13897 |
| 364 | JGI24696J40584_12947853 | 3300002834 | Bacteria | 1971 |
| 365 | Ga0074311_1142962 | 3300005317 | Bacteria | 1697 |
| 366 | Ga0074263_105375 | 3300005485 | Bacteria | 1510 |
| 367 | Ga0102735_1004642 | 3300007080 | Bacteria | 1803 |
| 368 | Ga0466731_317888 | 3300042622 | Unclassified | 3000 |
| 369 | Ga0466735_031773 | 3300042624 | Bacteria | 1050 |
| 370 | Ga0466705_400168 | 3300042612 | Bacteria | 5825 |
| 371 | Ga0466718_052638 | 3300042617 | Bacteria | 2099 |
| 372 | Ga0466718_063874 | 3300042617 | Unclassified | 8218 |
| 373 | Ga0466718_118492 | 3300042617 | Bacteria | 13144 |
| 374 | Ga0466718_123721 | 3300042617 | Bacteria | 1165 |
| 375 | Ga0466718_165519 | 3300042617 | Bacteria | 8982 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.