Protein Family IF02071
Metagenome
Isolate
378
Members
328
Samples
104
Scaffolds
253.44
Avg Length
Representative Sequence
- ID
- 3300009453|Ga0127656_100082|Ga0127656_10008245
- Length
- 263 aa
- Sequence
- VNRGKNMIRLYWIALQSIWIKEIIRFSRIWVQTLLPPVITMSLYFVIFGSLMGSRIGNMGDVDYMQFIVPGLIMMAVITNAYANVASSFFNAKYQRNIEELLVAPVPTYIVIIGYIGGGVARGVITGVLVTGVSSFFVPLQVYSWSILVLVLLLTAILFSLGGLLNAVFAKTFDDISLVPTFVLTPLTYLGGVFYSLSLLPPLWQDLSKLNPIVYMVSGFRYGFLGMTELSLPLTLSVLITFISVFYTLAWYLINRGQGLRS*
Sample Types
Isolate
72.5%
Metagenome
27.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.0%
Apidae
23.5%
Formicidae
4.9%
Drosophilidae
4.9%
Muscidae
4.2%
Tenebrionidae
3.3%
Curculionidae
3.3%
Calliphoridae
2.6%
Aphididae
2.3%
Culicidae
2.0%
Termitidae
2.0%
Elmidae
1.6%
Tephritidae
1.6%
Scarabaeidae
1.3%
Palinuridae
1.0%
Talitridae
1.0%
Cerambycidae
1.0%
Blattidae
0.7%
Glossinidae
0.7%
Chrysomelidae
0.7%
Plutellidae
0.7%
Majidae
0.7%
Passalidae
0.7%
Sarcophagidae
0.7%
Noctuidae
0.7%
Armadillidiidae
0.7%
Lysianassidae
0.3%
Aleyrodidae
0.3%
Libellulidae
0.3%
Pentatomidae
0.3%
Rhopalidae
0.3%
Penaeidae
0.3%
Carabidae
0.3%
Ceratophyllidae
0.3%
Nephropidae
0.3%
Crambidae
0.3%
Thripidae
0.3%
Anthomyiidae
0.3%
Gomphidae
0.3%
Artemiidae
0.3%
Anthocoridae
0.3%
Taxonomy
Archaea
0
Bacteria
355
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 2 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 3 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 4 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 5 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 6 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 7 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 8 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 9 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 10 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 11 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 12 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 13 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 14 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 15 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 16 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 17 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 18 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 19 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 20 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 21 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 22 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 23 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 24 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 25 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 26 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 27 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 28 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 29 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 30 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 31 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 32 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 33 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 34 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 35 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 36 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 37 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 38 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 39 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 40 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 41 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 42 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 43 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 44 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 45 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 46 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 47 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 50 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 51 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 52 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 53 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 54 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 55 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 56 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 57 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 58 | 2820411483 | Unclassified Firmicutes Lab288P4bin76 | Isolate | Unclassified |
| 59 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 60 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 61 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 62 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 63 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 64 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 65 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 66 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 67 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 68 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 69 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 70 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 71 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 72 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 73 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 74 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 75 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 76 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 77 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 78 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 79 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 80 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 81 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 82 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 83 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 84 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 85 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 86 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 87 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 88 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 89 | 2998830186 | Enterobacteriaceae endosymbiont of Plateumaris pusilla PpusSym | Isolate | Chrysomelidae |
| 90 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 91 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 92 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 93 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 94 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 95 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 96 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 97 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 98 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 99 | 2511231135 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans | Isolate | Glossinidae |
| 100 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 101 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 102 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 103 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 104 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 105 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 106 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 107 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 108 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 109 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 110 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 111 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 112 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 113 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 114 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 115 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 116 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 117 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 118 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 119 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 120 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 121 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 122 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 123 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 124 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 125 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 126 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 127 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 128 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 129 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 130 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 131 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 132 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 133 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 134 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 135 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 136 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 137 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 138 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 139 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 140 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 141 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 142 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 143 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 144 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 145 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 146 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 147 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 148 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 149 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 150 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 151 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 152 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 153 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 154 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 155 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 156 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 157 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 158 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 159 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 160 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 161 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 162 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 163 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 164 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 165 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 166 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 167 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 168 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 169 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 170 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 171 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 172 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 173 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 174 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 175 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 176 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 177 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 178 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 179 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 180 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 181 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 182 | 2999135268 | Enterobacteriaceae endosymbiont of Plateumaris sericea PserSym | Isolate | Chrysomelidae |
| 183 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 184 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 185 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 186 | 2035265002 | Agrotis sp. gut microbial communities from Texas A and M University, USA | Metagenome | Noctuidae |
| 187 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 188 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 189 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 190 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 191 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 192 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 193 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 194 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 195 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 196 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 197 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 198 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 199 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 200 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 201 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 202 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 203 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 204 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 205 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 206 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 207 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 208 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 209 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 210 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 211 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 212 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 213 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 214 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 215 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 216 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 217 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Drosophilidae |
| 218 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 219 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 220 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 221 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 222 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 223 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 224 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 225 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 226 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 227 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 228 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 229 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 230 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 231 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 232 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 233 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 234 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 235 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 236 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 237 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 238 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 239 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 240 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 241 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 242 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 243 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 244 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 245 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 246 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 247 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 248 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 249 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 250 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 251 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 252 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 253 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 254 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 255 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 256 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 257 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 258 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 259 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 260 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 261 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 262 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 263 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 264 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 265 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 266 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 267 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 268 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 269 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 270 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 271 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 272 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 273 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 274 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 275 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 276 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 277 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 278 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 279 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 280 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 281 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 282 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 283 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 284 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 285 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 286 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 287 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 288 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 289 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 290 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 291 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 292 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 293 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 294 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 295 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 296 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 297 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 298 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 299 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 300 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 301 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 302 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 303 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 304 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 305 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 306 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 307 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 308 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 309 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 310 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 311 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 312 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 313 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 314 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 315 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 316 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 317 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 318 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 319 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 320 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 321 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 322 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 323 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 324 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 325 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 326 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 327 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 328 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0530661_000145 | 3300056564 | Unclassified | 63015 |
| 2 | Ga0562375_0018 | 3300056856 | Bacteria | 940838 |
| 3 | gam1t_NODE_596804_length=4274_GC=35_2_Contigs=4 | 2189573031 | Bacteria | 4304 |
| 4 | JGI24703J35330_11713555 | 3300002501 | Unclassified | 2225 |
| 5 | Ga0074309_1001574 | 3300005314 | Unclassified | 3090 |
| 6 | Ga0102739_1000581 | 3300007095 | Bacteria | 7254 |
| 7 | Ga0123355_10044533 | 3300009826 | Bacteria | 7223 |
| 8 | Ga0123355_10409145 | 3300009826 | Bacteria | 1743 |
| 9 | Ga0123355_10440370 | 3300009826 | Unclassified | 1650 |
| 10 | Ga0466724_62885 | 3300042649 | Bacteria | 30963 |
| 11 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 12 | Ga0562378_0193 | 3300056814 | Bacteria | 149270 |
| 13 | 2227080770 | 2225789004 | Bacteria | 234484 |
| 14 | IMNBL1DRAFT_c0008012 | 3300000062 | Bacteria | 5445 |
| 15 | Meta3P_1000402 | 3300002464 | Bacteria | 34913 |
| 16 | JGI24703J35330_11748553 | 3300002501 | Bacteria | 19725 |
| 17 | Ga0103260_1000131 | 3300007139 | Unclassified | 17975 |
| 18 | Ga0466713_022509 | 3300042602 | Bacteria | 91675 |
| 19 | Ga0466713_065405 | 3300042602 | Bacteria | 109397 |
| 20 | Ga0466730_007179 | 3300042625 | Bacteria | 7586 |
| 21 | Ga0530661_000216 | 3300056564 | Bacteria | 47873 |
| 22 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 23 | Ga0562379_0075 | 3300056790 | Bacteria | 407558 |
| 24 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 25 | DPOL_contig14784 | 2035918003 | Bacteria | 105378 |
| 26 | gam1t_NODE_608056_length=128205_GC=35_0_Contigs=2 | 2189573031 | Bacteria | 128215 |
| 27 | JGI24703J35330_11747204 | 3300002501 | Bacteria | 6327 |
| 28 | JGI24703J35330_11747527 | 3300002501 | Bacteria | 7187 |
| 29 | JGI24703J35330_11748295 | 3300002501 | Bacteria | 13391 |
| 30 | WW0001_100130 | 3300002732 | Bacteria | 100882 |
| 31 | Ga0052191_103393 | 3300003097 | Bacteria | 2660 |
| 32 | Ga0063521_1000287 | 3300003973 | Bacteria | 30974 |
| 33 | Ga0102733_100213 | 3300006995 | Unclassified | 3129 |
| 34 | Ga0102736_1000430 | 3300007052 | Bacteria | 8648 |
| 35 | Ga0103264_1000781 | 3300007188 | Bacteria | 14712 |
| 36 | Ga0127656_100082 | 3300009453 | Bacteria | 50010 |
| 37 | Ga0265387_1000373 | 3300024582 | Bacteria | 7295 |
| 38 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 39 | Ga0123355_10030787 | 3300009826 | Bacteria | 8701 |
| 40 | Ga0136159_1000113 | 3300010217 | Bacteria | 54371 |
| 41 | Ga0466730_020778 | 3300042625 | Bacteria | 16564 |
| 42 | Ga0063521_1000216 | 3300003973 | Bacteria | 41019 |
| 43 | Ga0063521_1000220 | 3300003973 | Bacteria | 40459 |
| 44 | Ga0074188_1040402 | 3300005318 | Bacteria | 2053 |
| 45 | Ga0074188_1155063 | 3300005318 | Bacteria | 8490 |
| 46 | Ga0103267_1000413 | 3300007190 | Bacteria | 23039 |
| 47 | Ga0316159_10382 | 3300030930 | Bacteria | 6996 |
| 48 | Ga0123355_10152787 | 3300009826 | Bacteria | 3501 |
| 49 | Ga0466730_003721 | 3300042625 | Bacteria | 18568 |
| 50 | Ga0466730_075999 | 3300042625 | Unclassified | 9818 |
| 51 | Ga0466730_079495 | 3300042625 | Unclassified | 1939 |
| 52 | Ga0562379_0092 | 3300056790 | Bacteria | 317609 |
| 53 | Ga0562378_0955 | 3300056814 | Bacteria | 37078 |
| 54 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 55 | SCG598B02_11520 | 3300000472 | Bacteria | 28594 |
| 56 | Ga0074309_1005610 | 3300005314 | Bacteria | 1488 |
| 57 | Ga0103265_1000378 | 3300007068 | Unclassified | 10737 |
| 58 | Ga0103265_1000523 | 3300007068 | Bacteria | 11938 |
| 59 | Ga0104049_1026501 | 3300007103 | Unclassified | 2170 |
| 60 | Ga0104041_1031625 | 3300007106 | Bacteria | 3037 |
| 61 | Ga0105553_1041533 | 3300007767 | Bacteria | 13801 |
| 62 | Ga0466707_417535 | 3300042601 | Unclassified | 1229 |
| 63 | Ga0160433_101586 | 3300012846 | Unclassified | 5994 |
| 64 | Ga0247289_0259 | 3300035363 | Unclassified | 10424 |
| 65 | Ga0247290_00207 | 3300035364 | Unclassified | 17358 |
| 66 | Ga0466724_20901 | 3300042649 | Unclassified | 3662 |
| 67 | Ga0466724_26929 | 3300042649 | Bacteria | 1437 |
| 68 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 69 | CwormDRAF_NODE_41582_len_2630_cov_10_926616 | 2035265002 | Unclassified | 2660 |
| 70 | JGI24703J35330_11748838 | 3300002501 | Bacteria | 45299 |
| 71 | Ga0063521_1000243 | 3300003973 | Bacteria | 36894 |
| 72 | Ga0074278_112256 | 3300005721 | Bacteria | 128215 |
| 73 | Ga0103266_1000226 | 3300007067 | Bacteria | 15888 |
| 74 | Ga0102735_1000196 | 3300007080 | Bacteria | 15430 |
| 75 | Ga0102740_1000579 | 3300007140 | Unclassified | 9993 |
| 76 | Ga0103264_1000303 | 3300007188 | Bacteria | 27740 |
| 77 | Ga0105005_1032556 | 3300007505 | Bacteria | 7292 |
| 78 | Ga0160433_101142 | 3300012846 | Bacteria | 8038 |
| 79 | Ga0466702_123942 | 3300042635 | Bacteria | 50613 |
| 80 | Ga0562379_0419 | 3300056790 | Bacteria | 91895 |
| 81 | Ga0562375_0019 | 3300056856 | Bacteria | 921384 |
| 82 | Ga0562375_0063 | 3300056856 | Bacteria | 420368 |
| 83 | FGTW_contig08387 | 2065487013 | Unclassified | 1887 |
| 84 | FGTW_contig14834 | 2065487013 | Unclassified | 2224 |
| 85 | CVPL010L_1000287 | 3300002932 | Bacteria | 29554 |
| 86 | CVPL005W_1000091 | 3300002934 | Bacteria | 39163 |
| 87 | Ga0103261_1000130 | 3300007083 | Bacteria | 13902 |
| 88 | Ga0104042_1121346 | 3300007130 | Bacteria | 1769 |
| 89 | Ga0160460_100024 | 3300012845 | Bacteria | 337641 |
| 90 | Ga0466730_012861 | 3300042625 | Bacteria | 2378 |
| 91 | Ga0562379_1947 | 3300056790 | Unclassified | 19989 |
| 92 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 93 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 94 | FGTW_contig17531 | 2065487013 | Unclassified | 1239 |
| 95 | JGI24703J35330_11736233 | 3300002501 | Bacteria | 3023 |
| 96 | JGI24700J35501_10930763 | 3300002508 | Bacteria | 22240 |
| 97 | CVPL010L_1000095 | 3300002932 | Bacteria | 82017 |
| 98 | Ga0074278_103290 | 3300005721 | Bacteria | 4304 |
| 99 | Ga0103268_1000146 | 3300007192 | Bacteria | 23319 |
| 100 | Ga0127657_100454 | 3300009457 | Bacteria | 29977 |
| 101 | Ga0160457_1000161 | 3300012858 | Unclassified | 66816 |
| 102 | Ga0265387_1000051 | 3300024582 | Bacteria | 38557 |
| 103 | Ga0247290_00217 | 3300035364 | Unclassified | 16444 |
| 104 | Ga0123355_10032557 | 3300009826 | Bacteria | 8463 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.