Protein Family IF01774
Metagenome
Isolate
577
Members
221
Samples
456
Scaffolds
314.34
Avg Length
Representative Sequence
- ID
- 3300007142|Ga0102737_1000268|Ga0102737_100026815
- Length
- 373 aa
- Sequence
- MFSFLWICSFVKVLFIETRWIINQKEKTLSKNDIFKSVLIFLIQLKYILLRLLVVHKITMSYIEPEAKIFACSQSVYLAEKIAQHYGVSLGKITLSRFSDGEFQPSYEESIRGLRVFIVCSTFPNSDNLMELLLMIDAAKRASARHITAVIPYFGWARQDRKDQPRVPIGAKLVANLLQAAGATRIMTMDLHADQIQGFFEKPVDHLFASTIFLPYVKSLKLSNLTIASPDMGGSKRAYAYSKFLHSDVVICYKQRKKANEIGIMELIGEVTNRNVILVDDMVDTGGTLAKAANLMIEKGALSVRAICTHPILSKDAYLKIEESKLEELIVTDSIPLKKESKKIKVVSCAPLFAEVMKMVQHNNSISGKFLM*
Sample Types
Isolate
21.0%
Metagenome
79.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
15.5%
Unclassified
13.5%
Blattidae
7.2%
Kalotermitidae
6.8%
Cryptocercidae
5.8%
Formicidae
5.3%
Elmidae
4.3%
Blaberidae
4.3%
Culicidae
3.9%
Blattellidae
3.4%
Drosophilidae
3.4%
Armadillidiidae
3.4%
Apidae
2.4%
Rhinotermitidae
2.4%
Hydrophilidae
1.9%
Pseudophyllodromiidae
1.9%
Corydiidae
1.4%
Termopsidae
1.4%
Passalidae
1.0%
Anaplectidae
1.0%
Daphniidae
1.0%
Tenebrionidae
1.0%
Ectobiidae
1.0%
Nyctiboridae
1.0%
Cambaridae
1.0%
Aphididae
0.5%
Thomisidae
0.5%
Hodotermitidae
0.5%
Harpacticidae
0.5%
Tryonicidae
0.5%
Nephropidae
0.5%
Lamproblattidae
0.5%
Bombycidae
0.5%
Monophlebidae
0.5%
Kiwaidae
0.5%
Taxonomy
Archaea
0
Bacteria
516
Eukaryota
0
Viruses
0
Unclassified
61
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 2 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 3 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 4 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 5 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 6 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 7 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 8 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 9 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 10 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 11 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 12 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 13 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 14 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 17 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 18 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 19 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 20 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 21 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 22 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 23 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 24 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 25 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 26 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 27 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 28 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 29 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 30 | 2630969010 | Friedmanniella luteola DSM 21741 | Isolate | Thomisidae |
| 31 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 32 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 33 | 3002025727 | Blattabacterium cuenoti EUPHYsp | Isolate | Pseudophyllodromiidae |
| 34 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 35 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 36 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 37 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 38 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 39 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 40 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 41 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 44 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 45 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 46 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 47 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 48 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 49 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 50 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 51 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 52 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 53 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 54 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 55 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 56 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 57 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 58 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 59 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 60 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 61 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 62 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 63 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 64 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 65 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 66 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 67 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 68 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 69 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 70 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 71 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 72 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 73 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 74 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 75 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 76 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 77 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 78 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 79 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 80 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 81 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 82 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 83 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 84 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 85 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 86 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 87 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 88 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 89 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 90 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 91 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 92 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 93 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 94 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 95 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 96 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 97 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 98 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 99 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 100 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 101 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 102 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 103 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 104 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 105 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 106 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 107 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 108 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 109 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 110 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 111 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 112 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 113 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 114 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 115 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 116 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 117 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 118 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 119 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 120 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 121 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 122 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 123 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 124 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 125 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 126 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 127 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 128 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 129 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 130 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 131 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 132 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 133 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 134 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 135 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 136 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 137 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 138 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 139 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 140 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 141 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 142 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 143 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 144 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 145 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 146 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 147 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 148 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 149 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 150 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 151 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 152 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 153 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 154 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 155 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 156 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 157 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 158 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 159 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 160 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 161 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 162 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 163 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 164 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 165 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 166 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 167 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 168 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 169 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 170 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 171 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 172 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 173 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 174 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 175 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 176 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 177 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 178 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 179 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 180 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 181 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 182 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 183 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 184 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 185 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 186 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 187 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 188 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 189 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 190 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 191 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 192 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 193 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 194 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 195 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 196 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 197 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 198 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 199 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 200 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 201 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 202 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 203 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 204 | 3002003370 | Blattabacterium cuenoti THEREAreg | Isolate | Corydiidae |
| 205 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 206 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 207 | 3002008367 | Blattabacterium cuenoti PARANAUcir | Isolate | Blaberidae |
| 208 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 209 | 3002028747 | Blattabacterium cuenoti ESCALves | Isolate | Blattellidae |
| 210 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 211 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 212 | 3300005320 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 2 gut | Metagenome | Drosophilidae |
| 213 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 214 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 215 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 216 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 217 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 218 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 219 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 220 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 221 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_247976 | 3300042611 | Bacteria | 1331 |
| 2 | Ga0466705_075558 | 3300042612 | Bacteria | 7516 |
| 3 | Ga0466705_240325 | 3300042612 | Unclassified | 5637 |
| 4 | Ga0466733_168068 | 3300042659 | Bacteria | 2403 |
| 5 | Ga0466701_055538 | 3300042598 | Unclassified | 2077 |
| 6 | Ga0466701_097392 | 3300042598 | Bacteria | 1914 |
| 7 | Ga0466706_012647 | 3300042599 | Bacteria | 17151 |
| 8 | Ga0466706_119351 | 3300042599 | Unclassified | 1065 |
| 9 | Ga0466700_046297 | 3300042600 | Bacteria | 17673 |
| 10 | Ga0466700_431622 | 3300042600 | Bacteria | 8194 |
| 11 | Ga0466707_065313 | 3300042601 | Bacteria | 19443 |
| 12 | Ga0466707_165139 | 3300042601 | Bacteria | 5774 |
| 13 | Ga0466707_362407 | 3300042601 | Bacteria | 4794 |
| 14 | Ga0466713_058794 | 3300042602 | Bacteria | 46658 |
| 15 | Ga0466719_241012 | 3300042606 | Bacteria | 1738 |
| 16 | Ga0466720_055033 | 3300042607 | Unclassified | 2134 |
| 17 | Ga0466722_125590 | 3300042609 | Bacteria | 2344 |
| 18 | Ga0466710_015156 | 3300042613 | Bacteria | 1714 |
| 19 | Ga0466711_069341 | 3300042615 | Bacteria | 69315 |
| 20 | Ga0466711_163201 | 3300042615 | Bacteria | 3248 |
| 21 | Ga0466711_284692 | 3300042615 | Bacteria | 28031 |
| 22 | Ga0466715_016367 | 3300042616 | Bacteria | 26019 |
| 23 | Ga0466715_483459 | 3300042616 | Bacteria | 9809 |
| 24 | Ga0466723_119122 | 3300042618 | Bacteria | 3542 |
| 25 | Ga0160430_117104 | 3300012852 | Bacteria | 1061 |
| 26 | Ga0466690_048289 | 3300042590 | Unclassified | 6723 |
| 27 | Ga0466692_172080 | 3300042591 | Bacteria | 48787 |
| 28 | Ga0466693_296033 | 3300042592 | Bacteria | 1381 |
| 29 | Ga0466696_244978 | 3300042596 | Bacteria | 67990 |
| 30 | Ga0123357_10006965 | 3300009784 | Bacteria | 13898 |
| 31 | Ga0123357_10007183 | 3300009784 | Bacteria | 13716 |
| 32 | Ga0123355_10055912 | 3300009826 | Bacteria | 6389 |
| 33 | Ga0123356_10141344 | 3300010049 | Bacteria | 2375 |
| 34 | Ga0123356_10279300 | 3300010049 | Unclassified | 1764 |
| 35 | Ga0466734_109147 | 3300042623 | Bacteria | 1424 |
| 36 | Ga0466703_237911 | 3300042636 | Unclassified | 3016 |
| 37 | Ga0466704_598010 | 3300042643 | Unclassified | 12387 |
| 38 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 39 | Ga0466708_214081 | 3300042652 | Bacteria | 27299 |
| 40 | Ga0466727_192131 | 3300042655 | Unclassified | 1778 |
| 41 | 2227507953 | 2225789004 | Bacteria | 68720 |
| 42 | IMNBL1DRAFT_c0005455 | 3300000062 | Bacteria | 7263 |
| 43 | JGI24699J35502_11133657 | 3300002509 | Bacteria | 13094 |
| 44 | Ga0068305_10238840 | 3300005083 | Bacteria | 3096 |
| 45 | Ga0072940_1070437 | 3300005200 | Bacteria | 2689 |
| 46 | Ga0104019_1003745 | 3300007150 | Bacteria | 5181 |
| 47 | Ga0104050_1002153 | 3300007153 | Bacteria | 1808 |
| 48 | Ga0103267_1000368 | 3300007190 | Bacteria | 30698 |
| 49 | Ga0103267_1000614 | 3300007190 | Bacteria | 18974 |
| 50 | Ga0123357_10000085 | 3300009784 | Bacteria | 75372 |
| 51 | Ga0466733_018595 | 3300042659 | Bacteria | 17740 |
| 52 | Ga0466733_153045 | 3300042659 | Bacteria | 2790 |
| 53 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 54 | Ga0466706_130781 | 3300042599 | Bacteria | 43652 |
| 55 | Ga0466706_247189 | 3300042599 | Bacteria | 6792 |
| 56 | Ga0466700_152167 | 3300042600 | Bacteria | 8846 |
| 57 | Ga0466707_117588 | 3300042601 | Bacteria | 1355 |
| 58 | Ga0466713_005070 | 3300042602 | Bacteria | 6527 |
| 59 | Ga0466713_050956 | 3300042602 | Bacteria | 9601 |
| 60 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 61 | Ga0466714_047885 | 3300042603 | Bacteria | 3618 |
| 62 | Ga0466714_116335 | 3300042603 | Bacteria | 10855 |
| 63 | Ga0466714_141644 | 3300042603 | Bacteria | 1328 |
| 64 | Ga0466714_144026 | 3300042603 | Bacteria | 4424 |
| 65 | Ga0466717_218089 | 3300042604 | Unclassified | 1296 |
| 66 | Ga0466716_029364 | 3300042605 | Bacteria | 6213 |
| 67 | Ga0466716_231749 | 3300042605 | Bacteria | 2354 |
| 68 | Ga0466719_574755 | 3300042606 | Bacteria | 8613 |
| 69 | Ga0466711_160747 | 3300042615 | Bacteria | 18294 |
| 70 | Ga0466715_151257 | 3300042616 | Unclassified | 1468 |
| 71 | Ga0466715_185456 | 3300042616 | Bacteria | 34905 |
| 72 | Ga0466715_254895 | 3300042616 | Bacteria | 4676 |
| 73 | Ga0466728_026827 | 3300042620 | Bacteria | 4961 |
| 74 | Ga0466728_117583 | 3300042620 | Bacteria | 1785 |
| 75 | Ga0466729_106723 | 3300042621 | Bacteria | 9657 |
| 76 | Ga0160433_100524 | 3300012846 | Bacteria | 17607 |
| 77 | Ga0160448_100206 | 3300012854 | Bacteria | 24645 |
| 78 | Ga0466656_015753 | 3300042550 | Bacteria | 1964 |
| 79 | Ga0466656_054067 | 3300042550 | Bacteria | 21036 |
| 80 | Ga0466690_024809 | 3300042590 | Bacteria | 4720 |
| 81 | Ga0466690_034055 | 3300042590 | Bacteria | 5415 |
| 82 | Ga0466691_012676 | 3300042593 | Bacteria | 25732 |
| 83 | Ga0466691_063828 | 3300042593 | Bacteria | 36439 |
| 84 | Ga0466694_353574 | 3300042594 | Bacteria | 1688 |
| 85 | Ga0466695_319571 | 3300042595 | Bacteria | 12193 |
| 86 | Ga0466696_164899 | 3300042596 | Bacteria | 8575 |
| 87 | Ga0466696_460406 | 3300042596 | Bacteria | 4679 |
| 88 | Ga0123356_10016846 | 3300010049 | Bacteria | 6965 |
| 89 | Ga0123356_10060770 | 3300010049 | Bacteria | 3527 |
| 90 | Ga0123353_10000005 | 3300010167 | Bacteria | 308504 |
| 91 | Ga0123353_10000318 | 3300010167 | Bacteria | 59562 |
| 92 | Ga0123353_10314571 | 3300010167 | Bacteria | 2380 |
| 93 | Ga0466735_143509 | 3300042624 | Bacteria | 3484 |
| 94 | Ga0466735_229456 | 3300042624 | Bacteria | 8338 |
| 95 | Ga0466703_046310 | 3300042636 | Bacteria | 18035 |
| 96 | Ga0466703_377137 | 3300042636 | Bacteria | 6492 |
| 97 | Ga0466704_049875 | 3300042643 | Bacteria | 80175 |
| 98 | Ga0466704_179826 | 3300042643 | Bacteria | 45154 |
| 99 | Ga0466724_32902 | 3300042649 | Bacteria | 5162 |
| 100 | Ga0466708_004946 | 3300042652 | Unclassified | 13804 |
| 101 | Ga0466708_206183 | 3300042652 | Bacteria | 28300 |
| 102 | Ga0466708_218084 | 3300042652 | Bacteria | 32715 |
| 103 | Ga0466727_186786 | 3300042655 | Bacteria | 4615 |
| 104 | JGI24705J35276_12181802 | 3300002504 | Bacteria | 1375 |
| 105 | JGI24699J35502_11134019 | 3300002509 | Bacteria | 24668 |
| 106 | Ga0072941_1130605 | 3300005201 | Bacteria | 4814 |
| 107 | Ga0104048_1171680 | 3300007143 | Unclassified | 1439 |
| 108 | Ga0104019_1003180 | 3300007150 | Bacteria | 2330 |
| 109 | Ga0466705_090460 | 3300042612 | Bacteria | 4787 |
| 110 | Ga0466733_146028 | 3300042659 | Bacteria | 5280 |
| 111 | Ga0466706_011539 | 3300042599 | Bacteria | 1367 |
| 112 | Ga0466706_042350 | 3300042599 | Bacteria | 1992 |
| 113 | Ga0466706_091549 | 3300042599 | Bacteria | 8430 |
| 114 | Ga0466706_139595 | 3300042599 | Bacteria | 14709 |
| 115 | Ga0466706_201837 | 3300042599 | Bacteria | 3385 |
| 116 | Ga0466707_284455 | 3300042601 | Bacteria | 10541 |
| 117 | Ga0466707_340092 | 3300042601 | Bacteria | 13724 |
| 118 | Ga0466713_070366 | 3300042602 | Bacteria | 55899 |
| 119 | Ga0466714_066985 | 3300042603 | Bacteria | 1151 |
| 120 | Ga0466714_162705 | 3300042603 | Bacteria | 1216 |
| 121 | Ga0466697_046177 | 3300042611 | Bacteria | 1798 |
| 122 | Ga0466711_152784 | 3300042615 | Bacteria | 16681 |
| 123 | Ga0466715_011037 | 3300042616 | Bacteria | 18221 |
| 124 | Ga0466715_135537 | 3300042616 | Bacteria | 10334 |
| 125 | Ga0466723_164021 | 3300042618 | Bacteria | 38027 |
| 126 | Ga0466723_354129 | 3300042618 | Bacteria | 22312 |
| 127 | Ga0466726_123460 | 3300042619 | Bacteria | 8579 |
| 128 | Ga0466726_158935 | 3300042619 | Bacteria | 13251 |
| 129 | Ga0466726_279826 | 3300042619 | Bacteria | 2542 |
| 130 | Ga0466729_116601 | 3300042621 | Bacteria | 6871 |
| 131 | Ga0160472_100759 | 3300012839 | Unclassified | 14367 |
| 132 | Ga0265387_1002890 | 3300024582 | Bacteria | 2402 |
| 133 | Ga0466657_361922 | 3300042582 | Bacteria | 3186 |
| 134 | Ga0466657_371177 | 3300042582 | Bacteria | 9204 |
| 135 | Ga0466690_155374 | 3300042590 | Bacteria | 7037 |
| 136 | Ga0466690_195608 | 3300042590 | Bacteria | 5752 |
| 137 | Ga0466690_234429 | 3300042590 | Bacteria | 10272 |
| 138 | Ga0466690_360656 | 3300042590 | Bacteria | 9810 |
| 139 | Ga0466692_061431 | 3300042591 | Bacteria | 6922 |
| 140 | Ga0466691_059717 | 3300042593 | Unclassified | 3759 |
| 141 | Ga0466691_173679 | 3300042593 | Bacteria | 10823 |
| 142 | Ga0466696_276992 | 3300042596 | Bacteria | 1978 |
| 143 | Ga0466701_007250 | 3300042598 | Bacteria | 45914 |
| 144 | Ga0123355_10000036 | 3300009826 | Bacteria | 135537 |
| 145 | Ga0123356_10022070 | 3300010049 | Bacteria | 6012 |
| 146 | Ga0123356_10026008 | 3300010049 | Bacteria | 5502 |
| 147 | Ga0123356_10089989 | 3300010049 | Bacteria | 2921 |
| 148 | Ga0123353_10070883 | 3300010167 | Bacteria | 5600 |
| 149 | Ga0123353_10819800 | 3300010167 | Unclassified | 1281 |
| 150 | Ga0123354_10008888 | 3300010882 | Bacteria | 15323 |
| 151 | Ga0123354_10020403 | 3300010882 | Unclassified | 10424 |
| 152 | Ga0466703_105253 | 3300042636 | Bacteria | 2955 |
| 153 | Ga0466704_152142 | 3300042643 | Bacteria | 5313 |
| 154 | Ga0466709_252710 | 3300042648 | Bacteria | 20192 |
| 155 | Ga0466709_304600 | 3300042648 | Bacteria | 78097 |
| 156 | Ga0466708_406580 | 3300042652 | Unclassified | 8249 |
| 157 | 2227591300 | 2225789004 | Bacteria | 12950 |
| 158 | IMNBL1DRAFT_c0001943 | 3300000062 | Bacteria | 14894 |
| 159 | JGI24705J35276_12236527 | 3300002504 | Bacteria | 8270 |
| 160 | Ga0104045_1001689 | 3300007085 | Bacteria | 14133 |
| 161 | Ga0104045_1006525 | 3300007085 | Bacteria | 8138 |
| 162 | Ga0102740_1000145 | 3300007140 | Unclassified | 19338 |
| 163 | Ga0103264_1000008 | 3300007188 | Bacteria | 140843 |
| 164 | Ga0123357_10000601 | 3300009784 | Bacteria | 35612 |
| 165 | Ga0466697_115048 | 3300042611 | Bacteria | 26962 |
| 166 | Ga0466705_276741 | 3300042612 | Bacteria | 8377 |
| 167 | Ga0466733_027552 | 3300042659 | Bacteria | 2403 |
| 168 | Ga0466733_122871 | 3300042659 | Bacteria | 2537 |
| 169 | Ga0466706_092947 | 3300042599 | Bacteria | 13597 |
| 170 | Ga0466706_163906 | 3300042599 | Bacteria | 105365 |
| 171 | Ga0466713_044128 | 3300042602 | Bacteria | 11957 |
| 172 | Ga0466714_055129 | 3300042603 | Bacteria | 4485 |
| 173 | Ga0466714_157676 | 3300042603 | Bacteria | 4265 |
| 174 | Ga0466719_191695 | 3300042606 | Bacteria | 16014 |
| 175 | Ga0466722_097726 | 3300042609 | Bacteria | 28120 |
| 176 | Ga0466715_067917 | 3300042616 | Bacteria | 42568 |
| 177 | Ga0466715_163279 | 3300042616 | Bacteria | 13475 |
| 178 | Ga0466715_361265 | 3300042616 | Bacteria | 6401 |
| 179 | Ga0466723_034648 | 3300042618 | Bacteria | 11027 |
| 180 | Ga0466728_246581 | 3300042620 | Bacteria | 7783 |
| 181 | Ga0466728_387586 | 3300042620 | Bacteria | 4254 |
| 182 | Ga0160468_100270 | 3300012819 | Bacteria | 26594 |
| 183 | Ga0160443_100014 | 3300012848 | Bacteria | 456539 |
| 184 | Ga0160457_1001847 | 3300012858 | Bacteria | 5175 |
| 185 | Ga0160457_1003814 | 3300012858 | Bacteria | 2527 |
| 186 | Ga0466656_231412 | 3300042550 | Bacteria | 2460 |
| 187 | Ga0466657_365774 | 3300042582 | Unclassified | 1729 |
| 188 | Ga0466690_407203 | 3300042590 | Bacteria | 13121 |
| 189 | Ga0466691_043474 | 3300042593 | Bacteria | 28261 |
| 190 | Ga0466691_199426 | 3300042593 | Bacteria | 29697 |
| 191 | Ga0466696_176628 | 3300042596 | Bacteria | 1024 |
| 192 | Ga0466701_008829 | 3300042598 | Unclassified | 2773 |
| 193 | Ga0123353_10000110 | 3300010167 | Bacteria | 95473 |
| 194 | Ga0123353_10046218 | 3300010167 | Bacteria | 6915 |
| 195 | Ga0123353_10158323 | 3300010167 | Bacteria | 3607 |
| 196 | Ga0123353_10195645 | 3300010167 | Bacteria | 3187 |
| 197 | Ga0123353_10465238 | 3300010167 | Bacteria | 1856 |
| 198 | Ga0123353_10510220 | 3300010167 | Bacteria | 1748 |
| 199 | Ga0123354_10174828 | 3300010882 | Bacteria | 2480 |
| 200 | Ga0160442_100056 | 3300012806 | Bacteria | 156115 |
| 201 | Ga0466735_033617 | 3300042624 | Bacteria | 4935 |
| 202 | Ga0466730_039089 | 3300042625 | Unclassified | 5013 |
| 203 | Ga0466703_094354 | 3300042636 | Bacteria | 3499 |
| 204 | Ga0466703_353002 | 3300042636 | Unclassified | 1975 |
| 205 | Ga0466703_416143 | 3300042636 | Unclassified | 3503 |
| 206 | Ga0466724_23916 | 3300042649 | Bacteria | 557842 |
| 207 | HBC_ctgsDRAFT_1000047 | 3300000333 | Bacteria | 29893 |
| 208 | JGI24698J34947_10040158 | 3300002449 | Bacteria | 2418 |
| 209 | JGI24702J35022_10003999 | 3300002462 | Bacteria | 8841 |
| 210 | JGI24705J35276_12220976 | 3300002504 | Bacteria | 2305 |
| 211 | JGI24699J35502_11084438 | 3300002509 | Bacteria | 2026 |
| 212 | CVPL010W_10000014 | 3300002931 | Bacteria | 89080 |
| 213 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 214 | Ga0072941_1066966 | 3300005201 | Bacteria | 6662 |
| 215 | Ga0103265_1002193 | 3300007068 | Unclassified | 3037 |
| 216 | Ga0102739_1000003 | 3300007095 | Bacteria | 77722 |
| 217 | Ga0102737_1000268 | 3300007142 | Bacteria | 17642 |
| 218 | Ga0103267_1000440 | 3300007190 | Bacteria | 16831 |
| 219 | Ga0103267_1002554 | 3300007190 | Unclassified | 4676 |
| 220 | Ga0466733_088973 | 3300042659 | Bacteria | 15510 |
| 221 | Ga0466733_192818 | 3300042659 | Unclassified | 3543 |
| 222 | Ga0466733_210904 | 3300042659 | Bacteria | 42489 |
| 223 | Ga0466701_086935 | 3300042598 | Bacteria | 154395 |
| 224 | Ga0466706_172646 | 3300042599 | Bacteria | 40300 |
| 225 | Ga0466700_336947 | 3300042600 | Bacteria | 1142 |
| 226 | Ga0466707_131171 | 3300042601 | Bacteria | 11165 |
| 227 | Ga0466707_234770 | 3300042601 | Bacteria | 11125 |
| 228 | Ga0466707_411337 | 3300042601 | Unclassified | 12669 |
| 229 | Ga0466713_139066 | 3300042602 | Bacteria | 109882 |
| 230 | Ga0466714_013204 | 3300042603 | Bacteria | 6499 |
| 231 | Ga0466714_021097 | 3300042603 | Bacteria | 2668 |
| 232 | Ga0466714_034071 | 3300042603 | Bacteria | 3801 |
| 233 | Ga0466714_142328 | 3300042603 | Bacteria | 2942 |
| 234 | Ga0466716_042107 | 3300042605 | Unclassified | 5485 |
| 235 | Ga0466716_249765 | 3300042605 | Unclassified | 2908 |
| 236 | Ga0466716_422761 | 3300042605 | Bacteria | 2445 |
| 237 | Ga0466719_201532 | 3300042606 | Unclassified | 5473 |
| 238 | Ga0466719_356439 | 3300042606 | Bacteria | 2584 |
| 239 | Ga0466722_110457 | 3300042609 | Bacteria | 2838 |
| 240 | Ga0466705_476675 | 3300042612 | Bacteria | 9557 |
| 241 | Ga0466710_133768 | 3300042613 | Bacteria | 3392 |
| 242 | Ga0466715_387019 | 3300042616 | Bacteria | 4898 |
| 243 | Ga0466723_106397 | 3300042618 | Bacteria | 24890 |
| 244 | Ga0466723_144121 | 3300042618 | Bacteria | 6410 |
| 245 | Ga0466723_150610 | 3300042618 | Bacteria | 8682 |
| 246 | Ga0466723_258950 | 3300042618 | Bacteria | 6188 |
| 247 | Ga0466726_346060 | 3300042619 | Bacteria | 5727 |
| 248 | Ga0466728_239927 | 3300042620 | Bacteria | 19099 |
| 249 | Ga0466728_462844 | 3300042620 | Bacteria | 7066 |
| 250 | Ga0160433_100197 | 3300012846 | Bacteria | 49261 |
| 251 | Ga0466690_361434 | 3300042590 | Bacteria | 3066 |
| 252 | Ga0466692_046951 | 3300042591 | Bacteria | 32415 |
| 253 | Ga0466692_081030 | 3300042591 | Bacteria | 11624 |
| 254 | Ga0466692_133670 | 3300042591 | Bacteria | 6252 |
| 255 | Ga0466694_138596 | 3300042594 | Bacteria | 2180 |
| 256 | Ga0466696_158949 | 3300042596 | Bacteria | 9151 |
| 257 | Ga0123356_10197114 | 3300010049 | Bacteria | 2050 |
| 258 | Ga0123353_10299876 | 3300010167 | Bacteria | 2454 |
| 259 | Ga0123353_10346588 | 3300010167 | Bacteria | 2241 |
| 260 | Ga0160464_103314 | 3300012805 | Bacteria | 2372 |
| 261 | Ga0466735_040789 | 3300042624 | Bacteria | 7555 |
| 262 | Ga0466730_054806 | 3300042625 | Bacteria | 801523 |
| 263 | Ga0466703_026505 | 3300042636 | Bacteria | 16565 |
| 264 | Ga0466703_311949 | 3300042636 | Unclassified | 6136 |
| 265 | Ga0466724_36590 | 3300042649 | Bacteria | 4503 |
| 266 | IMNBL1DRAFT_c0001690 | 3300000062 | Bacteria | 16262 |
| 267 | Ga0104043_1091456 | 3300007058 | Bacteria | 2478 |
| 268 | Ga0104045_1080462 | 3300007085 | Bacteria | 1199 |
| 269 | Ga0102740_1001099 | 3300007140 | Unclassified | 7078 |
| 270 | Ga0104019_1005410 | 3300007150 | Unclassified | 4133 |
| 271 | Ga0103267_1000492 | 3300007190 | Unclassified | 15192 |
| 272 | Ga0466705_239478 | 3300042612 | Bacteria | 22573 |
| 273 | Ga0466705_300270 | 3300042612 | Unclassified | 3632 |
| 274 | Ga0466732_116379 | 3300042656 | Bacteria | 1773 |
| 275 | Ga0466732_374787 | 3300042656 | Bacteria | 4087 |
| 276 | Ga0466733_197586 | 3300042659 | Unclassified | 11155 |
| 277 | Ga0466701_029528 | 3300042598 | Bacteria | 1288 |
| 278 | Ga0466706_006747 | 3300042599 | Unclassified | 2913 |
| 279 | Ga0466700_035204 | 3300042600 | Bacteria | 1637 |
| 280 | Ga0466707_201520 | 3300042601 | Bacteria | 4300 |
| 281 | Ga0466707_361813 | 3300042601 | Bacteria | 12501 |
| 282 | Ga0466713_040261 | 3300042602 | Bacteria | 4349 |
| 283 | Ga0466714_080065 | 3300042603 | Bacteria | 1315 |
| 284 | Ga0466721_400029 | 3300042608 | Bacteria | 3163 |
| 285 | Ga0466722_042869 | 3300042609 | Unclassified | 9882 |
| 286 | Ga0466697_005347 | 3300042611 | Bacteria | 2586 |
| 287 | Ga0466712_115965 | 3300042614 | Bacteria | 5042 |
| 288 | Ga0466711_299619 | 3300042615 | Bacteria | 4377 |
| 289 | Ga0466711_483153 | 3300042615 | Bacteria | 5711 |
| 290 | Ga0466726_171856 | 3300042619 | Bacteria | 2112 |
| 291 | Ga0466726_336219 | 3300042619 | Bacteria | 2066 |
| 292 | Ga0466728_164559 | 3300042620 | Bacteria | 5490 |
| 293 | Ga0160469_101637 | 3300012824 | Unclassified | 5478 |
| 294 | Ga0160472_100040 | 3300012839 | Bacteria | 228958 |
| 295 | Ga0466657_302129 | 3300042582 | Bacteria | 2564 |
| 296 | Ga0466690_037079 | 3300042590 | Bacteria | 8628 |
| 297 | Ga0466691_008954 | 3300042593 | Bacteria | 17062 |
| 298 | Ga0466691_103922 | 3300042593 | Bacteria | 19126 |
| 299 | Ga0466691_116149 | 3300042593 | Bacteria | 88653 |
| 300 | Ga0466696_049142 | 3300042596 | Bacteria | 1862 |
| 301 | Ga0466696_069715 | 3300042596 | Bacteria | 52641 |
| 302 | Ga0466696_433372 | 3300042596 | Bacteria | 8512 |
| 303 | Ga0123353_10060210 | 3300010167 | Bacteria | 6089 |
| 304 | Ga0123353_10249231 | 3300010167 | Bacteria | 2752 |
| 305 | Ga0123353_10582518 | 3300010167 | Bacteria | 1605 |
| 306 | Ga0123354_10001820 | 3300010882 | Bacteria | 26942 |
| 307 | Ga0160465_100041 | 3300012803 | Bacteria | 162896 |
| 308 | Ga0466729_198901 | 3300042621 | Bacteria | 4566 |
| 309 | Ga0466734_118508 | 3300042623 | Bacteria | 1913 |
| 310 | Ga0466734_136734 | 3300042623 | Bacteria | 2732 |
| 311 | Ga0466735_007771 | 3300042624 | Bacteria | 3028 |
| 312 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 313 | Ga0466703_031031 | 3300042636 | Bacteria | 3692 |
| 314 | Ga0466704_549692 | 3300042643 | Bacteria | 18942 |
| 315 | Ga0466709_036192 | 3300042648 | Unclassified | 3780 |
| 316 | Ga0466709_280167 | 3300042648 | Bacteria | 7473 |
| 317 | Ga0466708_057031 | 3300042652 | Bacteria | 7904 |
| 318 | Ga0466708_101521 | 3300042652 | Bacteria | 25266 |
| 319 | Ga0466725_371636 | 3300042654 | Bacteria | 1709 |
| 320 | TM1208_contig03887 | 2021593000 | Bacteria | 2218 |
| 321 | IMNBL1DRAFT_c0006251 | 3300000062 | Bacteria | 6543 |
| 322 | JGI24702J35022_10010494 | 3300002462 | Bacteria | 5171 |
| 323 | JGI24702J35022_10033430 | 3300002462 | Bacteria | 2751 |
| 324 | JGI24696J40584_12933114 | 3300002834 | Bacteria | 1514 |
| 325 | JGI24696J40584_12958040 | 3300002834 | Bacteria | 3845 |
| 326 | JGI24696J40584_12959564 | 3300002834 | Bacteria | 5299 |
| 327 | Ga0074317_1000511 | 3300005320 | Bacteria | 5241 |
| 328 | Ga0103268_1000292 | 3300007192 | Bacteria | 40849 |
| 329 | Ga0466732_207775 | 3300042656 | Bacteria | 1531 |
| 330 | Ga0466733_019356 | 3300042659 | Bacteria | 61537 |
| 331 | Ga0466733_142214 | 3300042659 | Bacteria | 6894 |
| 332 | Ga0466733_145979 | 3300042659 | Bacteria | 1367 |
| 333 | Ga0466706_106204 | 3300042599 | Bacteria | 73373 |
| 334 | Ga0466700_452789 | 3300042600 | Bacteria | 3791 |
| 335 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 336 | Ga0466713_023768 | 3300042602 | Bacteria | 12396 |
| 337 | Ga0466713_140837 | 3300042602 | Bacteria | 175760 |
| 338 | Ga0466714_011295 | 3300042603 | Bacteria | 9252 |
| 339 | Ga0466714_016410 | 3300042603 | Bacteria | 2090 |
| 340 | Ga0466714_057087 | 3300042603 | Unclassified | 3288 |
| 341 | Ga0466714_059498 | 3300042603 | Bacteria | 52958 |
| 342 | Ga0466714_076457 | 3300042603 | Bacteria | 1439 |
| 343 | Ga0466716_053881 | 3300042605 | Bacteria | 4120 |
| 344 | Ga0466715_066047 | 3300042616 | Bacteria | 13658 |
| 345 | Ga0466715_205744 | 3300042616 | Bacteria | 41900 |
| 346 | Ga0466715_268020 | 3300042616 | Bacteria | 18370 |
| 347 | Ga0466715_271425 | 3300042616 | Bacteria | 1662 |
| 348 | Ga0466728_010406 | 3300042620 | Unclassified | 9379 |
| 349 | Ga0466728_081437 | 3300042620 | Bacteria | 3401 |
| 350 | Ga0160458_100548 | 3300012832 | Bacteria | 14575 |
| 351 | Ga0466690_016216 | 3300042590 | Unclassified | 9469 |
| 352 | Ga0466696_395845 | 3300042596 | Bacteria | 5821 |
| 353 | Ga0466701_005366 | 3300042598 | Unclassified | 1712 |
| 354 | Ga0123355_10000009 | 3300009826 | Bacteria | 191038 |
| 355 | Ga0123356_10000726 | 3300010049 | Bacteria | 36353 |
| 356 | Ga0123353_10030709 | 3300010167 | Bacteria | 8309 |
| 357 | Ga0123353_10164654 | 3300010167 | Bacteria | 3526 |
| 358 | Ga0123354_10001393 | 3300010882 | Bacteria | 29210 |
| 359 | Ga0123354_10009255 | 3300010882 | Bacteria | 15061 |
| 360 | Ga0123354_10028708 | 3300010882 | Bacteria | 8758 |
| 361 | Ga0466735_089041 | 3300042624 | Bacteria | 2563 |
| 362 | Ga0466735_145213 | 3300042624 | Bacteria | 1884 |
| 363 | Ga0466703_028411 | 3300042636 | Bacteria | 5903 |
| 364 | Ga0466703_327285 | 3300042636 | Bacteria | 5335 |
| 365 | Ga0466704_227206 | 3300042643 | Bacteria | 5952 |
| 366 | Ga0466709_084097 | 3300042648 | Bacteria | 147707 |
| 367 | Ga0466709_241783 | 3300042648 | Bacteria | 17495 |
| 368 | Ga0466709_341609 | 3300042648 | Bacteria | 14139 |
| 369 | Ga0466708_052338 | 3300042652 | Bacteria | 19084 |
| 370 | Ga0466708_078773 | 3300042652 | Unclassified | 3884 |
| 371 | Ga0466708_132874 | 3300042652 | Bacteria | 15716 |
| 372 | Ga0466708_148211 | 3300042652 | Bacteria | 8788 |
| 373 | Ga0466727_088136 | 3300042655 | Bacteria | 36415 |
| 374 | Ga0466727_154054 | 3300042655 | Bacteria | 1313 |
| 375 | 2227330766 | 2225789004 | Bacteria | 29081 |
| 376 | IMNBL1DRAFT_c0006328 | 3300000062 | Bacteria | 6491 |
| 377 | IMNBL1DRAFT_c0013007 | 3300000062 | Bacteria | 3765 |
| 378 | Ga0068305_10002010 | 3300005083 | Bacteria | 184777 |
| 379 | Ga0072941_1005886 | 3300005201 | Bacteria | 3984 |
| 380 | Ga0102736_1000094 | 3300007052 | Bacteria | 21783 |
| 381 | Ga0104041_1001851 | 3300007106 | Unclassified | 5709 |
| 382 | Ga0102734_1000279 | 3300007129 | Unclassified | 15730 |
| 383 | Ga0104050_1002286 | 3300007153 | Bacteria | 3610 |
| 384 | Ga0127649_101006 | 3300009460 | Bacteria | 15478 |
| 385 | Ga0123357_10002584 | 3300009784 | Bacteria | 20307 |
| 386 | Ga0123357_10002688 | 3300009784 | Bacteria | 20027 |
| 387 | Ga0466697_227036 | 3300042611 | Bacteria | 2590 |
| 388 | Ga0466733_060503 | 3300042659 | Bacteria | 102825 |
| 389 | Ga0466733_070395 | 3300042659 | Bacteria | 8366 |
| 390 | Ga0466733_100596 | 3300042659 | Bacteria | 3977 |
| 391 | Ga0466701_101679 | 3300042598 | Bacteria | 1936 |
| 392 | Ga0466706_025520 | 3300042599 | Unclassified | 1761 |
| 393 | Ga0466706_139308 | 3300042599 | Bacteria | 26067 |
| 394 | Ga0466700_223219 | 3300042600 | Bacteria | 7372 |
| 395 | Ga0466707_418902 | 3300042601 | Bacteria | 1821 |
| 396 | Ga0466713_038044 | 3300042602 | Bacteria | 17226 |
| 397 | Ga0466713_097550 | 3300042602 | Unclassified | 5672 |
| 398 | Ga0466713_121587 | 3300042602 | Bacteria | 21118 |
| 399 | Ga0466714_059586 | 3300042603 | Bacteria | 1225 |
| 400 | Ga0466714_065131 | 3300042603 | Bacteria | 171349 |
| 401 | Ga0466714_087602 | 3300042603 | Bacteria | 3491 |
| 402 | Ga0466714_088648 | 3300042603 | Unclassified | 2993 |
| 403 | Ga0466714_100132 | 3300042603 | Bacteria | 6864 |
| 404 | Ga0466714_143631 | 3300042603 | Bacteria | 1579 |
| 405 | Ga0466716_054953 | 3300042605 | Unclassified | 7765 |
| 406 | Ga0466716_092066 | 3300042605 | Unclassified | 2743 |
| 407 | Ga0466719_085886 | 3300042606 | Unclassified | 1716 |
| 408 | Ga0466698_123847 | 3300042610 | Bacteria | 1687 |
| 409 | Ga0466710_042254 | 3300042613 | Bacteria | 2624 |
| 410 | Ga0466710_112588 | 3300042613 | Bacteria | 1382 |
| 411 | Ga0466710_364199 | 3300042613 | Bacteria | 9456 |
| 412 | Ga0466710_419555 | 3300042613 | Unclassified | 3240 |
| 413 | Ga0466711_123433 | 3300042615 | Bacteria | 18878 |
| 414 | Ga0466711_318475 | 3300042615 | Bacteria | 3972 |
| 415 | Ga0466715_011625 | 3300042616 | Bacteria | 28911 |
| 416 | Ga0466723_273369 | 3300042618 | Unclassified | 13483 |
| 417 | Ga0466726_051125 | 3300042619 | Bacteria | 2353 |
| 418 | Ga0466726_396431 | 3300042619 | Bacteria | 1514 |
| 419 | Ga0466729_099954 | 3300042621 | Bacteria | 3740 |
| 420 | Ga0160441_100013 | 3300012825 | Bacteria | 353830 |
| 421 | Ga0160444_100181 | 3300012841 | Bacteria | 58432 |
| 422 | Ga0160445_100518 | 3300012847 | Bacteria | 18648 |
| 423 | Ga0157631_138558 | 3300013007 | Bacteria | 5992 |
| 424 | Ga0264413_158942 | 3300024493 | Bacteria | 2140 |
| 425 | Ga0466657_229008 | 3300042582 | Bacteria | 97233 |
| 426 | Ga0466657_345390 | 3300042582 | Bacteria | 2596 |
| 427 | Ga0466690_265256 | 3300042590 | Bacteria | 5010 |
| 428 | Ga0466690_347017 | 3300042590 | Bacteria | 16944 |
| 429 | Ga0466691_001267 | 3300042593 | Bacteria | 4497 |
| 430 | Ga0466696_309694 | 3300042596 | Bacteria | 28647 |
| 431 | Ga0123353_10004302 | 3300010167 | Bacteria | 18304 |
| 432 | Ga0123353_10020608 | 3300010167 | Bacteria | 9857 |
| 433 | Ga0123353_10316045 | 3300010167 | Bacteria | 2373 |
| 434 | Ga0123354_10103225 | 3300010882 | Unclassified | 3836 |
| 435 | Ga0160464_100128 | 3300012805 | Bacteria | 85878 |
| 436 | Ga0466735_013173 | 3300042624 | Bacteria | 6727 |
| 437 | Ga0466735_073249 | 3300042624 | Bacteria | 30975 |
| 438 | Ga0466704_241551 | 3300042643 | Unclassified | 2749 |
| 439 | Ga0466724_03451 | 3300042649 | Bacteria | 343609 |
| 440 | Ga0466724_56509 | 3300042649 | Bacteria | 13433 |
| 441 | Ga0466708_268977 | 3300042652 | Bacteria | 7280 |
| 442 | Ga0466725_046129 | 3300042654 | Bacteria | 2722 |
| 443 | Ga0466725_372243 | 3300042654 | Bacteria | 6642 |
| 444 | IMNBL1DRAFT_c0000172 | 3300000062 | Bacteria | 58110 |
| 445 | IMNBL1DRAFT_c0004637 | 3300000062 | Bacteria | 8165 |
| 446 | IMNBL1DRAFT_c0016501 | 3300000062 | Bacteria | 3158 |
| 447 | JGI24702J35022_10000494 | 3300002462 | Bacteria | 23836 |
| 448 | JGI24702J35022_10000794 | 3300002462 | Bacteria | 19551 |
| 449 | Meta3P_1011282 | 3300002464 | Bacteria | 10555 |
| 450 | JGI24705J35276_12233846 | 3300002504 | Bacteria | 5106 |
| 451 | CVPL010W_10002306 | 3300002931 | Unclassified | 22390 |
| 452 | Ga0072941_1188012 | 3300005201 | Bacteria | 4749 |
| 453 | Ga0103265_1000003 | 3300007068 | Bacteria | 137272 |
| 454 | Ga0102735_1000633 | 3300007080 | Unclassified | 6841 |
| 455 | Ga0104050_1027830 | 3300007153 | Bacteria | 1694 |
| 456 | Ga0103268_1004979 | 3300007192 | Unclassified | 2694 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.