Protein Family IF01462
Metagenome
Isolate
421
Members
392
Samples
81
Scaffolds
319.74
Avg Length
Representative Sequence
- ID
- 3300005721|Ga0074278_107214|Ga0074278_10721429
- Length
- 335 aa
- Sequence
- MLSDQITINKDLFMSKIFDDNSQTIGHTPLVRLKHFGNGNILAKVESRNPSFSIKCRIASNMIWDAEKRGLLTPDVELIEPTSGNTGIALASVAAARGYKLTLTMPESMSIERRKLLKALGANLVLTEAAKGMKGAIDKAEEIVASNPKRNIMLQQFSNPANPEIHEKTTGPEIWQDTDGKVDIFIAGVGTGGTFTGVVNYIKKSQGKNITAVAVEPTTSPVISQALAGEPIKPGAHKIQGIGAGFIPKNLDLSLIDLVEKVSNDQAIETARALMEKEGILAGISSGAAVFAADRLAKLPENANKMIVVILPSSGERYLSTDLFSGIFTEKELG*
Sample Types
Isolate
80.8%
Metagenome
19.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
30.2%
Unclassified
21.4%
Aphididae
9.4%
Drosophilidae
5.9%
Anthocoridae
5.6%
Muscidae
3.5%
Curculionidae
2.7%
Calliphoridae
2.4%
Tenebrionidae
2.1%
Culicidae
1.9%
Tephritidae
1.3%
Cerambycidae
1.1%
Termitidae
1.1%
Formicidae
1.1%
Talitridae
0.8%
Pteromalidae
0.8%
Palinuridae
0.8%
Passalidae
0.5%
Armadillidiidae
0.5%
Sarcophagidae
0.5%
Pentatomidae
0.5%
Elmidae
0.5%
Crambidae
0.3%
Thripidae
0.3%
Anthomyiidae
0.3%
Artemiidae
0.3%
Scarabaeidae
0.3%
Ceratophyllidae
0.3%
Nephropidae
0.3%
Termopsidae
0.3%
Hormaphididae
0.3%
Rhinotermitidae
0.3%
Reduviidae
0.3%
Rhopalidae
0.3%
Penaeidae
0.3%
Glossinidae
0.3%
Carabidae
0.3%
Daphniidae
0.3%
Aphrophoridae
0.3%
Cicadellidae
0.3%
Plutellidae
0.3%
Majidae
0.3%
Taxonomy
Archaea
0
Bacteria
394
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 3 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 4 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 5 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 6 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 7 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 8 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 9 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 10 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 11 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 12 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 13 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 14 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 15 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 16 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 17 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 18 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 19 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 20 | 3300009463 | Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov | Metagenome | |
| 21 | 3300009479 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov | Metagenome | Aphididae |
| 22 | 3300009539 | Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov | Metagenome | Aphididae |
| 23 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 24 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 25 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 26 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 27 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 28 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 29 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 30 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 31 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 32 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 33 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 34 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 35 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 36 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 37 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 38 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 39 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 40 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 41 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 42 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 43 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 44 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 45 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 46 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 47 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 48 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 49 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 50 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 51 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 52 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 53 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 54 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 55 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 56 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 57 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 58 | 2718218137 | Buchnera aphidicola (Diuraphis noxia) | Isolate | Aphididae |
| 59 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 60 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 61 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 62 | 3300009477 | Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov | Metagenome | |
| 63 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 64 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 65 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 66 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 67 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 68 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 69 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 70 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 71 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 72 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 73 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 74 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 75 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 76 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 77 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 78 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 79 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 80 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 81 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 82 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 83 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 84 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 85 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 86 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 87 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 88 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 89 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 90 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 91 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 92 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 93 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 94 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 95 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 96 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 97 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 98 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 99 | 2558860197 | Buchnera aphidicola F009 | Isolate | Aphididae |
| 100 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 101 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 102 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 103 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 104 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 105 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 106 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 107 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 108 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 109 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 110 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 111 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 112 | 3300009468 | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov | Metagenome | Aphididae |
| 113 | 3300009534 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov | Metagenome | |
| 114 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 115 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 116 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 117 | 2834887098 | Buchnera aphidicola LNK | Isolate | Aphididae |
| 118 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 119 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 120 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 121 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 122 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 123 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 124 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 125 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 126 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 127 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 128 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 129 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 130 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 131 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 132 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 133 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 134 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 135 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 136 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 137 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 138 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 139 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 140 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 141 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 142 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 143 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 144 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 145 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 146 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 147 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 148 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 149 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 150 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 151 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 152 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 153 | 2558860194 | Buchnera aphidicola USDA | Isolate | Aphididae |
| 154 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 155 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 156 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 157 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 158 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 159 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 160 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 161 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 162 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 163 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 164 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 165 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 166 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 167 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 168 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 169 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 170 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 171 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 172 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 173 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 174 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 175 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 176 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 177 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 178 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 179 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 180 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 181 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 182 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 183 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 184 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 185 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 186 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 187 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 188 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 189 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 190 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 191 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 192 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 193 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 194 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 195 | 2558860196 | Buchnera aphidicola W106 | Isolate | Aphididae |
| 196 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 197 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 198 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 199 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 200 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 201 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 202 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 203 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 204 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 205 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 206 | 3300009493 | Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov | Metagenome | Hormaphididae |
| 207 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 208 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 209 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 210 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 211 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 212 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 213 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 214 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 215 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 216 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 217 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 218 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 219 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 220 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 221 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 222 | 637000043 | Buchnera aphidicola APS | Isolate | Aphididae |
| 223 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 224 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 225 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 226 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 227 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 228 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 229 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 230 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 231 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 232 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 233 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 234 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 235 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 236 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 237 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 238 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 239 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 240 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 241 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 242 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 243 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 244 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 245 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 246 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 247 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 248 | 3300009531 | Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov | Metagenome | Aphididae |
| 249 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 250 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 251 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 252 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 253 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 254 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 255 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 256 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 257 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 258 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 259 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 260 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 261 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 262 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 263 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 264 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 265 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 266 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 267 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 268 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 269 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 270 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 271 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 272 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 273 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 274 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 275 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 276 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 277 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 278 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 279 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 280 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 281 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 282 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 283 | 8076028257 | Erwinia haradaeae ErCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 284 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 285 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 286 | 2511231158 | Buchnera aphidicola Ua | Isolate | Aphididae |
| 287 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 288 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 289 | 2558860195 | Buchnera aphidicola G002 | Isolate | Aphididae |
| 290 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 291 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 292 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 293 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 294 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 295 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 296 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 297 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 298 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 299 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 300 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 301 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 302 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 303 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 304 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 305 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 306 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 307 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 308 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 309 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 310 | 3300009456 | Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov | Metagenome | |
| 311 | 3300009458 | Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov | Metagenome | |
| 312 | 3300009533 | Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov | Metagenome | |
| 313 | 3300009535 | Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov | Metagenome | Aphididae |
| 314 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 315 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 316 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 317 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 318 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 319 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 320 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 321 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 322 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 323 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 324 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 325 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 326 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 327 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 328 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 329 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 330 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 331 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 332 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 333 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 334 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 335 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 336 | 650377915 | Buchnera aphidicola JF98 | Isolate | Aphididae |
| 337 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 338 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 339 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 340 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 341 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 342 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 343 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 344 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 345 | 2511231206 | Buchnera aphidicola Ak | Isolate | Aphididae |
| 346 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 347 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 348 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 349 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 350 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 351 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 352 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 353 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 354 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 355 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 356 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 357 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 358 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 359 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 360 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 361 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 362 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 363 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 364 | 3300009482 | Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov | Metagenome | |
| 365 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 366 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 367 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 368 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 369 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 370 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 371 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 372 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 373 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 374 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 375 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 376 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 377 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 378 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 379 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 380 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 381 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 382 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 383 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 384 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 385 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 386 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 387 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 388 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 389 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 390 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 391 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 392 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466730_069455 | 3300042625 | Unclassified | 1372 |
| 2 | DPOL_contig17261 | 2035918003 | Unclassified | 2180 |
| 3 | gam1t_NODE_175054_length=40960_GC=33_1_Contigs=1 | 2189573031 | Bacteria | 40960 |
| 4 | gam1t_NODE_669739_length=8382_GC=35_6_Contigs=7 | 2189573031 | Unclassified | 8442 |
| 5 | Meta3P_1003128 | 3300002464 | Bacteria | 11017 |
| 6 | CVPL010L_1000111 | 3300002932 | Bacteria | 91591 |
| 7 | Ga0063521_1000049 | 3300003973 | Bacteria | 105543 |
| 8 | Ga0063521_1000546 | 3300003973 | Bacteria | 16552 |
| 9 | Ga0074278_107214 | 3300005721 | Bacteria | 40960 |
| 10 | Ga0104041_1002096 | 3300007106 | Bacteria | 13671 |
| 11 | Ga0127530_118772 | 3300009468 | Unclassified | 1592 |
| 12 | Ga0127654_100011 | 3300009493 | Bacteria | 643543 |
| 13 | Ga0160448_100022 | 3300012854 | Bacteria | 202960 |
| 14 | Ga0265387_1001165 | 3300024582 | Unclassified | 3884 |
| 15 | Ga0466707_244994 | 3300042601 | Bacteria | 58518 |
| 16 | Ga0123353_10026235 | 3300010167 | Bacteria | 8896 |
| 17 | Ga0466735_128279 | 3300042624 | Bacteria | 20246 |
| 18 | Ga0466724_24899 | 3300042649 | Unclassified | 13514 |
| 19 | FGTW_contig30822 | 2065487013 | Unclassified | 8932 |
| 20 | gam1t_NODE_653572_length=78574_GC=34_2_Contigs=4 | 2189573031 | Bacteria | 78604 |
| 21 | Ga0063521_1000022 | 3300003973 | Bacteria | 133586 |
| 22 | Ga0127526_1000110 | 3300009535 | Bacteria | 643549 |
| 23 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 24 | Ga0466730_070044 | 3300042625 | Unclassified | 1372 |
| 25 | Ga0466724_22821 | 3300042649 | Unclassified | 13912 |
| 26 | HBC_ctgsDRAFT_1060105 | 3300000333 | Unclassified | 916 |
| 27 | SCG598I22_12240 | 3300000462 | Bacteria | 19127 |
| 28 | SCG598B02_12320 | 3300000472 | Bacteria | 34669 |
| 29 | Ga0063521_1000083 | 3300003973 | Bacteria | 78356 |
| 30 | Ga0104040_1000913 | 3300007149 | Unclassified | 7708 |
| 31 | Ga0160456_101940 | 3300012820 | Bacteria | 4352 |
| 32 | Ga0160433_108411 | 3300012846 | Unclassified | 1386 |
| 33 | Ga0247290_04587 | 3300035364 | Unclassified | 950 |
| 34 | Ga0466701_006396 | 3300042598 | Bacteria | 15368 |
| 35 | Ga0466730_017453 | 3300042625 | Bacteria | 55311 |
| 36 | Ga0466724_63114 | 3300042649 | Bacteria | 16473 |
| 37 | SCG598L16_135381 | 3300000490 | Unclassified | 4924 |
| 38 | Ga0074278_128980 | 3300005721 | Unclassified | 78604 |
| 39 | Ga0105553_1041791 | 3300007767 | Unclassified | 20434 |
| 40 | Ga0127524_100015 | 3300009478 | Bacteria | 633867 |
| 41 | Ga0127648_100046 | 3300009534 | Bacteria | 171066 |
| 42 | Ga0265387_1000006 | 3300024582 | Bacteria | 94016 |
| 43 | Ga0466722_209032 | 3300042609 | Bacteria | 43008 |
| 44 | Ga0562379_0043 | 3300056790 | Bacteria | 600332 |
| 45 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 46 | Ga0466730_046826 | 3300042625 | Unclassified | 1309 |
| 47 | Meta3P_1000442 | 3300002464 | Bacteria | 16086 |
| 48 | Ga0074188_1000302 | 3300005318 | Bacteria | 30444 |
| 49 | Ga0127646_100058 | 3300009458 | Bacteria | 571963 |
| 50 | Ga0127530_100232 | 3300009468 | Bacteria | 26084 |
| 51 | Ga0127522_100011 | 3300009477 | Bacteria | 644448 |
| 52 | Ga0127528_1000015 | 3300009533 | Bacteria | 619772 |
| 53 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 54 | Ga0466713_118038 | 3300042602 | Unclassified | 2627 |
| 55 | Ga0562377_0035 | 3300056842 | Bacteria | 679350 |
| 56 | Ga0562377_0091 | 3300056842 | Bacteria | 332624 |
| 57 | Ga0466730_004161 | 3300042625 | Unclassified | 42097 |
| 58 | DPOL_contig19623 | 2035918003 | Bacteria | 56085 |
| 59 | IMNBL1DRAFT_c0000806 | 3300000062 | Bacteria | 24670 |
| 60 | CVPL010L_1000739 | 3300002932 | Unclassified | 10558 |
| 61 | Ga0104042_1001127 | 3300007130 | Bacteria | 2853 |
| 62 | Ga0104147_1014228 | 3300007224 | Bacteria | 13999 |
| 63 | Ga0105005_1019096 | 3300007505 | Unclassified | 5685 |
| 64 | Ga0127645_118088 | 3300009461 | Bacteria | 20488 |
| 65 | Ga0127644_100036 | 3300009463 | Bacteria | 636219 |
| 66 | Ga0127529_1000015 | 3300009479 | Bacteria | 636679 |
| 67 | Ga0466730_032537 | 3300042625 | Unclassified | 5336 |
| 68 | Ga0466730_049527 | 3300042625 | Unclassified | 1309 |
| 69 | FGTW_contig29389 | 2065487013 | Unclassified | 1931 |
| 70 | 2227507943 | 2225789004 | Bacteria | 75030 |
| 71 | HBC_ctgsDRAFT_1001301 | 3300000333 | Bacteria | 5435 |
| 72 | Ga0074278_150101 | 3300005721 | Bacteria | 8442 |
| 73 | Ga0074278_153183 | 3300005721 | Unclassified | 11058 |
| 74 | Ga0127523_100016 | 3300009456 | Bacteria | 642955 |
| 75 | Ga0127521_100003 | 3300009539 | Bacteria | 647534 |
| 76 | Ga0466713_118367 | 3300042602 | Unclassified | 2406 |
| 77 | gam1t_NODE_658414_length=10978_GC=34_7_Contigs=9 | 2189573031 | Unclassified | 11058 |
| 78 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 79 | Ga0127527_100008 | 3300009482 | Bacteria | 420258 |
| 80 | Ga0127525_100070 | 3300009531 | Bacteria | 646221 |
| 81 | Ga0136160_1000047 | 3300010225 | Bacteria | 637579 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00291 | PALP | Pyridoxal-phosphate dependent enzyme | 22 | 312 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.