Protein Family IF01184
Metagenome
Metatranscriptome
Isolate
416
Members
258
Samples
251
Scaffolds
92.36
Avg Length
Representative Sequence
- ID
- 3300005083|Ga0068305_10030615|Ga0068305_1003061510
- Length
- 99 aa
- Sequence
- MARSLKKGPFCDHHLMKKVEDAVATQNTKAVIKTWSRRSTIFPNFIGLTFGVYNGKKHIPVHVTEQMVGHKLGEFSPTRTYRGHGAAKDGKDKKPQQN*
Sample Types
Isolate
39.7%
Metagenome
60.1%
MAG
0.0%
Metatranscriptome
0.2%
Single Cell
0.0%
Taxa Family Distribution
Apidae
21.3%
Drosophilidae
16.1%
Unclassified
12.9%
Termitidae
11.6%
Formicidae
8.8%
Ixodidae
6.8%
Kalotermitidae
5.6%
Blattidae
2.4%
Elmidae
2.0%
Termopsidae
1.6%
Psyllidae
1.2%
Culicidae
1.2%
Armadillidiidae
1.2%
Nephropidae
0.8%
Tenebrionidae
0.8%
Rhinotermitidae
0.8%
Passalidae
0.8%
Daphniidae
0.4%
Hodotermitidae
0.4%
Scarabaeidae
0.4%
Pseudococcidae
0.4%
Curculionidae
0.4%
Ceratopogonidae
0.4%
Cerambycidae
0.4%
Nymphalidae
0.4%
Muscidae
0.4%
Kiwaidae
0.4%
Taxonomy
Archaea
0
Bacteria
382
Eukaryota
0
Viruses
0
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 2 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 3 | 2854548700 | Acetobacter persici DmL_053 | Isolate | Drosophilidae |
| 4 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 5 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 6 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 7 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 8 | 2821312900 | Unclassified Proteobacteria Lab288P4bin16 | Isolate | Unclassified |
| 9 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 10 | 2718218151 | Rickettsia rickettsii Iowa Large Clone | Isolate | Ixodidae |
| 11 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 640753045 | Rickettsia canadensis McKiel | Isolate | Ixodidae |
| 14 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 15 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 16 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 17 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 18 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 19 | 2987037630 | Oecophyllibacter saccharovorans Ha5 | Isolate | Formicidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 24 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 25 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 26 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 29 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 32 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 33 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 34 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 35 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 36 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 37 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 38 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 39 | 2855972776 | Rickettsia colombianensi Adcor 2 | Isolate | Ixodidae |
| 40 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 41 | 2806310572 | Pukyongiella litopenaei SH-1 | Isolate | Unclassified |
| 42 | 2548876780 | Rickettsia sibirica BJ-90 | Isolate | Ixodidae |
| 43 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 44 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 45 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 46 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 47 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 48 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 49 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 50 | 8068887342 | Rickettsia asiatica Maytaro1284 | Isolate | Ixodidae |
| 51 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 52 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 53 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 54 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 55 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 56 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 57 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 58 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 59 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 60 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 61 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 62 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 63 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 64 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 65 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 66 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 67 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 68 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 69 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 70 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 71 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 72 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 73 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 74 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 75 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 76 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 77 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 78 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 79 | 2718217968 | Rickettsia rickettsii Iowa Small Clone | Isolate | Ixodidae |
| 80 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 81 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 82 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 83 | 2820098966 | Unclassified Proteobacteria Lab288P1bin49 | Isolate | Unclassified |
| 84 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 85 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 86 | 2582581025 | Rickettsia tamurae buchneri ISO7 | Isolate | Ixodidae |
| 87 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 88 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 89 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 90 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 91 | 644736402 | Rickettsia africae ESF-5 | Isolate | Ixodidae |
| 92 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 93 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 94 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 95 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 96 | 2967491045 | Entomobacter blattae G55GP | Isolate | Unclassified |
| 97 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 98 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 99 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 100 | 3300028918 | Ant gut bacterial community from Dolichoderus sp. 2-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC085 | Metagenome | Formicidae |
| 101 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 102 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 103 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 104 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 105 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 106 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 107 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 108 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 109 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 110 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 111 | 2695420964 | Hyphomicrobiales bacterium JR021 | Isolate | Unclassified |
| 112 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 113 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 114 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 115 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 116 | 2820082748 | Unclassified Proteobacteria Lab288P4bin14 | Isolate | Unclassified |
| 117 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 118 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 119 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 120 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 121 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 122 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 123 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 124 | 3300002451 | Arthropod gut microbial communities from Cuernavaca, Mexico - Contigs_Hibr_8mil | Metagenome | |
| 125 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 126 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 127 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 128 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 129 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 130 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 131 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 132 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 133 | 2834762790 | Rickettsia fournieri AUS118 | Isolate | Unclassified |
| 134 | 2843073756 | Oecophyllibacter saccharovorans Jb2 | Isolate | Formicidae |
| 135 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 136 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 137 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 138 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 139 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 140 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 141 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 142 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 143 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 144 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 145 | 2811994999 | Candidatus Rickettsia amblyommii An13 | Isolate | Ixodidae |
| 146 | 2816332302 | Candidatus Liberibacter asiaticus YCPsy | Isolate | Psyllidae |
| 147 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 148 | 638341178 | Rickettsia sibirica 246 | Isolate | Unclassified |
| 149 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 150 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 151 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 152 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 153 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 154 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 155 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 156 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 157 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 158 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 159 | 650716082 | Rickettsia conorii heilongjiangensis 054 | Isolate | Pseudococcidae |
| 160 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 161 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 162 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 163 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 164 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 165 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 166 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 167 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 168 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 169 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 170 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 171 | 2609460328 | Candidatus Hepatobacter penaei NHPB | Isolate | Unclassified |
| 172 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 173 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 174 | 2811995359 | Rickettsia bellii An04 | Isolate | Ixodidae |
| 175 | 640753044 | Rickettsia bellii OSU 85-389 | Isolate | Ixodidae |
| 176 | 644736403 | Rickettsia peacockii Rustic | Isolate | Ixodidae |
| 177 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 178 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 179 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 180 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 181 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 182 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 183 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 184 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 185 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 186 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 187 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 188 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 189 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 190 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 191 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 192 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 193 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 194 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 195 | 2834764525 | Rickettsia endosymbiont of Culicoides newsteadi RiCNE | Isolate | Ceratopogonidae |
| 196 | 2837008993 | Oecophyllibacter saccharovorans Ta1 | Isolate | Formicidae |
| 197 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 198 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 199 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 200 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 201 | 2548876922 | Rickettsia sibirica mongolitimonae HA-91 | Isolate | Ixodidae |
| 202 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 203 | 2597489904 | Rickettsia helvetica C9P9 | Isolate | Ixodidae |
| 204 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 205 | 2599185121 | Rickettsiales bacterium Ac37b | Isolate | Ixodidae |
| 206 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 207 | 2511231061 | Rickettsia slovaca 13-B | Isolate | Ixodidae |
| 208 | 644736336 | Candidatus Liberibacter asiaticus psy62 | Isolate | Psyllidae |
| 209 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 210 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 211 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 212 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 213 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 214 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 215 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 216 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 217 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 218 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 219 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 220 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 221 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 222 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 223 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 224 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 225 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 226 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 227 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 228 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 229 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 230 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 231 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 232 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 233 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 234 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 235 | 2820092068 | Unclassified Proteobacteria Lab288P3bin38 | Isolate | Unclassified |
| 236 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 237 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 238 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 239 | 647533204 | Rickettsia endosymbiont of Ixodes scapularis | Isolate | Ixodidae |
| 240 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 241 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 242 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 243 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 244 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 245 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 246 | 8063680480 | Candidatus Liberibacter asiaticus CoFLP | Isolate | Psyllidae |
| 247 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 248 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 249 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 250 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 251 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 252 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 253 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 254 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 255 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 256 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 257 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 258 | 3300021232 | Termite gut microbial communities from nest from French Guiana - FG16_14_4 mRNA SA | Metatranscriptome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_022289 | 3300042659 | Bacteria | 3534 |
| 2 | Ga0530661_036039 | 3300056564 | Bacteria | 1434 |
| 3 | Ga0466715_040556 | 3300042616 | Bacteria | 48791 |
| 4 | Ga0466715_551483 | 3300042616 | Bacteria | 6695 |
| 5 | Ga0466723_139659 | 3300042618 | Bacteria | 1551 |
| 6 | Ga0466723_267328 | 3300042618 | Bacteria | 8390 |
| 7 | Ga0466728_012515 | 3300042620 | Bacteria | 24746 |
| 8 | Ga0466728_314510 | 3300042620 | Bacteria | 3718 |
| 9 | Ga0466735_126077 | 3300042624 | Bacteria | 2160 |
| 10 | Ga0466703_118770 | 3300042636 | Bacteria | 3393 |
| 11 | Ga0466704_450748 | 3300042643 | Bacteria | 1836 |
| 12 | Ga0466708_073289 | 3300042652 | Bacteria | 2429 |
| 13 | Ga0466727_317390 | 3300042655 | Bacteria | 1222 |
| 14 | Ga0160443_104919 | 3300012848 | Bacteria | 1916 |
| 15 | Ga0160457_1003485 | 3300012858 | Unclassified | 2741 |
| 16 | Ga0309901_1000170 | 3300028918 | Bacteria | 25651 |
| 17 | Ga0309904_1000024 | 3300029810 | Bacteria | 18705 |
| 18 | Ga0466691_153507 | 3300042593 | Bacteria | 4198 |
| 19 | Ga0466696_137941 | 3300042596 | Bacteria | 25447 |
| 20 | Ga0466699_150118 | 3300042597 | Bacteria | 1275 |
| 21 | Ga0466706_069356 | 3300042599 | Bacteria | 23054 |
| 22 | Ga0466717_116469 | 3300042604 | Unclassified | 1618 |
| 23 | Ga0466716_085410 | 3300042605 | Bacteria | 1435 |
| 24 | Ga0466716_322489 | 3300042605 | Bacteria | 4232 |
| 25 | Ga0466716_386012 | 3300042605 | Bacteria | 1823 |
| 26 | Ga0466719_052800 | 3300042606 | Bacteria | 24279 |
| 27 | Ga0466722_144904 | 3300042609 | Bacteria | 627430 |
| 28 | Ga0123357_10593673 | 3300009784 | Bacteria | 855 |
| 29 | Ga0123355_11184494 | 3300009826 | Bacteria | 782 |
| 30 | Ga0123355_11408797 | 3300009826 | Unclassified | 688 |
| 31 | Ga0123356_10321323 | 3300010049 | Bacteria | 1661 |
| 32 | Ga0123356_13396658 | 3300010049 | Unclassified | 553 |
| 33 | Ga0123353_10130704 | 3300010167 | Bacteria | 4029 |
| 34 | JGI24705J35276_12227997 | 3300002504 | Bacteria | 3105 |
| 35 | JGI24705J35276_12228908 | 3300002504 | Unclassified | 3285 |
| 36 | CVPL005W_1081470 | 3300002934 | Unclassified | 666 |
| 37 | Ga0068302_10000197 | 3300005071 | Bacteria | 28753 |
| 38 | Ga0068305_10090202 | 3300005083 | Bacteria | 12636 |
| 39 | Ga0466733_050686 | 3300042659 | Bacteria | 13440 |
| 40 | Ga0466710_017395 | 3300042613 | Bacteria | 26782 |
| 41 | Ga0466711_328250 | 3300042615 | Bacteria | 50562 |
| 42 | Ga0466715_154133 | 3300042616 | Bacteria | 37484 |
| 43 | Ga0223676_1020723 | 3300021232 | Unclassified | 581 |
| 44 | Ga0415639_041375 | 3300038395 | Bacteria | 1286 |
| 45 | Ga0466657_201022 | 3300042582 | Bacteria | 28221 |
| 46 | Ga0466693_113441 | 3300042592 | Bacteria | 28543 |
| 47 | Ga0466694_144487 | 3300042594 | Unclassified | 1614 |
| 48 | Ga0466696_499008 | 3300042596 | Bacteria | 1725 |
| 49 | Ga0466706_054789 | 3300042599 | Bacteria | 17954 |
| 50 | Ga0466716_432455 | 3300042605 | Bacteria | 53884 |
| 51 | Ga0466719_444403 | 3300042606 | Bacteria | 4126 |
| 52 | Ga0466719_498852 | 3300042606 | Bacteria | 39193 |
| 53 | Ga0466698_049511 | 3300042610 | Bacteria | 20275 |
| 54 | Ga0123356_10370127 | 3300010049 | Bacteria | 1563 |
| 55 | Ga0123356_12624361 | 3300010049 | Bacteria | 631 |
| 56 | Ga0123353_10808680 | 3300010167 | Unclassified | 1293 |
| 57 | Ga0123354_10684793 | 3300010882 | Bacteria | 721 |
| 58 | Ga0160471_115963 | 3300012812 | Bacteria | 731 |
| 59 | JGI24695J34938_10045834 | 3300002450 | Unclassified | 1938 |
| 60 | CVPL010W_10068769 | 3300002931 | Bacteria | 665 |
| 61 | CVPL005L_10016301 | 3300002938 | Unclassified | 4596 |
| 62 | Ga0074278_139416 | 3300005721 | Bacteria | 58469 |
| 63 | Ga0466705_309138 | 3300042612 | Bacteria | 9773 |
| 64 | Ga0466711_227458 | 3300042615 | Bacteria | 3387 |
| 65 | Ga0466715_157029 | 3300042616 | Bacteria | 16118 |
| 66 | Ga0466715_352984 | 3300042616 | Bacteria | 2343 |
| 67 | Ga0466723_033190 | 3300042618 | Bacteria | 3202 |
| 68 | Ga0466728_460155 | 3300042620 | Bacteria | 45366 |
| 69 | Ga0466703_058568 | 3300042636 | Bacteria | 11852 |
| 70 | Ga0466703_245412 | 3300042636 | Bacteria | 7925 |
| 71 | Ga0466704_055691 | 3300042643 | Bacteria | 39736 |
| 72 | Ga0466704_360008 | 3300042643 | Bacteria | 4388 |
| 73 | Ga0466704_544575 | 3300042643 | Bacteria | 32697 |
| 74 | Ga0466709_000430 | 3300042648 | Bacteria | 9454 |
| 75 | Ga0160460_100431 | 3300012845 | Bacteria | 25502 |
| 76 | Ga0160430_137013 | 3300012852 | Bacteria | 582 |
| 77 | Ga0466690_296027 | 3300042590 | Bacteria | 2384 |
| 78 | Ga0466713_077596 | 3300042602 | Bacteria | 70669 |
| 79 | Ga0466716_477299 | 3300042605 | Bacteria | 3733 |
| 80 | Ga0123355_10024121 | 3300009826 | Bacteria | 9770 |
| 81 | Ga0123355_10409963 | 3300009826 | Unclassified | 1740 |
| 82 | Ga0123356_11269661 | 3300010049 | Unclassified | 901 |
| 83 | Ga0123353_12178778 | 3300010167 | Unclassified | 671 |
| 84 | 2227507956 | 2225789004 | Bacteria | 66298 |
| 85 | JGI24698J34947_10013524 | 3300002449 | Bacteria | 4454 |
| 86 | Ga0105524_103792 | 3300007733 | Bacteria | 4666 |
| 87 | Ga0466711_247281 | 3300042615 | Bacteria | 5801 |
| 88 | Ga0466711_461749 | 3300042615 | Bacteria | 3350 |
| 89 | Ga0466728_450528 | 3300042620 | Bacteria | 2389 |
| 90 | Ga0466703_195876 | 3300042636 | Bacteria | 4027 |
| 91 | Ga0466704_538627 | 3300042643 | Bacteria | 1170 |
| 92 | Ga0466708_274813 | 3300042652 | Bacteria | 19172 |
| 93 | Ga0466708_437863 | 3300042652 | Unclassified | 1065 |
| 94 | Ga0160436_1004933 | 3300012861 | Bacteria | 3150 |
| 95 | Ga0466657_233955 | 3300042582 | Bacteria | 3104 |
| 96 | Ga0466691_063786 | 3300042593 | Bacteria | 2826 |
| 97 | Ga0466691_168123 | 3300042593 | Bacteria | 38305 |
| 98 | Ga0466696_352216 | 3300042596 | Bacteria | 17315 |
| 99 | Ga0466706_221240 | 3300042599 | Bacteria | 1002 |
| 100 | Ga0466707_351878 | 3300042601 | Bacteria | 23367 |
| 101 | Ga0466713_154705 | 3300042602 | Bacteria | 6020 |
| 102 | Ga0466717_158699 | 3300042604 | Unclassified | 1120 |
| 103 | Ga0466716_537216 | 3300042605 | Bacteria | 1835 |
| 104 | Ga0123353_11043435 | 3300010167 | Bacteria | 1093 |
| 105 | Ga0123354_10141564 | 3300010882 | Bacteria | 2971 |
| 106 | Ga0123354_10601352 | 3300010882 | Bacteria | 806 |
| 107 | IMNBL1DRAFT_c0120169 | 3300000062 | Bacteria | 691 |
| 108 | Ga0068305_10009599 | 3300005083 | Bacteria | 20421 |
| 109 | Ga0102736_1009077 | 3300007052 | Unclassified | 1160 |
| 110 | Ga0104050_1212374 | 3300007153 | Unclassified | 900 |
| 111 | Ga0103264_1000777 | 3300007188 | Bacteria | 17197 |
| 112 | Ga0466697_135888 | 3300042611 | Bacteria | 1415 |
| 113 | Ga0466715_082922 | 3300042616 | Bacteria | 4026 |
| 114 | Ga0466723_038419 | 3300042618 | Bacteria | 31685 |
| 115 | Ga0466726_045398 | 3300042619 | Bacteria | 1049 |
| 116 | Ga0466728_240671 | 3300042620 | Bacteria | 17710 |
| 117 | Ga0466729_101370 | 3300042621 | Bacteria | 3610 |
| 118 | Ga0466729_143914 | 3300042621 | Bacteria | 3579 |
| 119 | Ga0466703_021871 | 3300042636 | Bacteria | 36991 |
| 120 | Ga0466703_071273 | 3300042636 | Bacteria | 5281 |
| 121 | Ga0466703_079639 | 3300042636 | Bacteria | 72500 |
| 122 | Ga0466703_152711 | 3300042636 | Bacteria | 41109 |
| 123 | Ga0466703_204168 | 3300042636 | Bacteria | 39826 |
| 124 | Ga0466703_416326 | 3300042636 | Bacteria | 4280 |
| 125 | Ga0466703_420955 | 3300042636 | Bacteria | 4262 |
| 126 | Ga0466704_332023 | 3300042643 | Bacteria | 37301 |
| 127 | Ga0466704_367182 | 3300042643 | Bacteria | 14991 |
| 128 | Ga0466704_578856 | 3300042643 | Bacteria | 15244 |
| 129 | Ga0466704_622441 | 3300042643 | Bacteria | 1507 |
| 130 | Ga0160441_100277 | 3300012825 | Bacteria | 49006 |
| 131 | Ga0415639_057445 | 3300038395 | Bacteria | 1467 |
| 132 | Ga0466690_194657 | 3300042590 | Bacteria | 1158 |
| 133 | Ga0466691_078633 | 3300042593 | Bacteria | 36589 |
| 134 | Ga0466691_141499 | 3300042593 | Bacteria | 52695 |
| 135 | Ga0466700_078521 | 3300042600 | Bacteria | 19884 |
| 136 | Ga0466716_429562 | 3300042605 | Bacteria | 29095 |
| 137 | Ga0123357_10287664 | 3300009784 | Bacteria | 1685 |
| 138 | Ga0123355_11703275 | 3300009826 | Unclassified | 600 |
| 139 | 2227524618 | 2225789004 | Bacteria | 16990 |
| 140 | AustNasuHG_c1073895 | 3300000089 | Bacteria | 602 |
| 141 | Vshibr_101716 | 3300002451 | Unclassified | 800 |
| 142 | JGI24702J35022_10159465 | 3300002462 | Bacteria | 1270 |
| 143 | JGI24705J35276_12227406 | 3300002504 | Unclassified | 2999 |
| 144 | WW0001_100122 | 3300002732 | Bacteria | 18415 |
| 145 | Ga0063521_1005379 | 3300003973 | Bacteria | 3028 |
| 146 | Ga0074278_135478 | 3300005721 | Unclassified | 4573 |
| 147 | Ga0102734_1000452 | 3300007129 | Bacteria | 16864 |
| 148 | Ga0103267_1039995 | 3300007190 | Bacteria | 1560 |
| 149 | Ga0123357_10000675 | 3300009784 | Bacteria | 34067 |
| 150 | Ga0562376_0794 | 3300056857 | Bacteria | 51236 |
| 151 | Ga0466711_143372 | 3300042615 | Bacteria | 4714 |
| 152 | Ga0466711_433893 | 3300042615 | Bacteria | 2823 |
| 153 | Ga0466723_053418 | 3300042618 | Bacteria | 1617 |
| 154 | Ga0466726_368971 | 3300042619 | Bacteria | 11532 |
| 155 | Ga0466728_162376 | 3300042620 | Unclassified | 1137 |
| 156 | Ga0466729_166896 | 3300042621 | Bacteria | 25680 |
| 157 | Ga0466734_006468 | 3300042623 | Bacteria | 11947 |
| 158 | Ga0466734_136931 | 3300042623 | Bacteria | 1191 |
| 159 | Ga0466735_089035 | 3300042624 | Bacteria | 1070 |
| 160 | Ga0466703_218222 | 3300042636 | Bacteria | 31588 |
| 161 | Ga0466703_300808 | 3300042636 | Bacteria | 4867 |
| 162 | Ga0466704_052100 | 3300042643 | Bacteria | 18824 |
| 163 | Ga0466704_308675 | 3300042643 | Bacteria | 1368 |
| 164 | Ga0309902_000001 | 3300028910 | Bacteria | 348555 |
| 165 | Ga0466657_357096 | 3300042582 | Bacteria | 4670 |
| 166 | Ga0466690_091622 | 3300042590 | Bacteria | 5894 |
| 167 | Ga0466690_164348 | 3300042590 | Bacteria | 1308 |
| 168 | Ga0466691_104973 | 3300042593 | Bacteria | 1839 |
| 169 | Ga0466691_111565 | 3300042593 | Bacteria | 13632 |
| 170 | Ga0466695_031129 | 3300042595 | Bacteria | 1116 |
| 171 | Ga0466717_291152 | 3300042604 | Bacteria | 2167 |
| 172 | Ga0466716_281593 | 3300042605 | Bacteria | 2506 |
| 173 | Ga0466719_544531 | 3300042606 | Bacteria | 1737 |
| 174 | Ga0466721_405028 | 3300042608 | Bacteria | 3772 |
| 175 | Ga0466697_044458 | 3300042611 | Unclassified | 1118 |
| 176 | Ga0123355_10173005 | 3300009826 | Bacteria | 3222 |
| 177 | Ga0123355_10480528 | 3300009826 | Unclassified | 1546 |
| 178 | Ga0123356_10021813 | 3300010049 | Bacteria | 6045 |
| 179 | Ga0123356_12470751 | 3300010049 | Unclassified | 650 |
| 180 | 2227245262 | 2225789004 | Bacteria | 1330 |
| 181 | CVPL005L_10000313 | 3300002938 | Bacteria | 46098 |
| 182 | Ga0068302_10094178 | 3300005071 | Bacteria | 2311 |
| 183 | Ga0068305_10180883 | 3300005083 | Bacteria | 1275 |
| 184 | Ga0102738_1000056 | 3300007141 | Bacteria | 46295 |
| 185 | Ga0466712_274900 | 3300042614 | Bacteria | 1231 |
| 186 | Ga0466703_280066 | 3300042636 | Bacteria | 1450 |
| 187 | Ga0466704_404182 | 3300042643 | Bacteria | 7663 |
| 188 | Ga0466727_155651 | 3300042655 | Bacteria | 48791 |
| 189 | Ga0160468_100004 | 3300012819 | Bacteria | 631412 |
| 190 | Ga0255572_1002106 | 3300026175 | Bacteria | 18119 |
| 191 | Ga0309903_100017 | 3300029809 | Bacteria | 18867 |
| 192 | Ga0466657_040762 | 3300042582 | Bacteria | 1416 |
| 193 | Ga0466690_160568 | 3300042590 | Bacteria | 1305 |
| 194 | Ga0466691_074179 | 3300042593 | Bacteria | 55711 |
| 195 | Ga0466691_100781 | 3300042593 | Unclassified | 4775 |
| 196 | Ga0466691_157039 | 3300042593 | Bacteria | 2175 |
| 197 | Ga0466696_118562 | 3300042596 | Bacteria | 1289 |
| 198 | Ga0466701_041816 | 3300042598 | Bacteria | 4999 |
| 199 | Ga0466713_060107 | 3300042602 | Bacteria | 12859 |
| 200 | Ga0466717_090600 | 3300042604 | Bacteria | 3042 |
| 201 | Ga0466719_480446 | 3300042606 | Bacteria | 45249 |
| 202 | Ga0123357_10674014 | 3300009784 | Unclassified | 754 |
| 203 | Ga0123355_10039511 | 3300009826 | Bacteria | 7677 |
| 204 | Ga0123356_11427503 | 3300010049 | Bacteria | 852 |
| 205 | Ga0123353_10045303 | 3300010167 | Bacteria | 6978 |
| 206 | Ga0123353_10544666 | 3300010167 | Bacteria | 1676 |
| 207 | JGI24698J34947_10106814 | 3300002449 | Unclassified | 1244 |
| 208 | JGI24705J35276_12234959 | 3300002504 | Bacteria | 6029 |
| 209 | CVPL010W_10000166 | 3300002931 | Bacteria | 56236 |
| 210 | CVPL005L_10009005 | 3300002938 | Bacteria | 8754 |
| 211 | Ga0068305_10030615 | 3300005083 | Bacteria | 16112 |
| 212 | Ga0103264_1000471 | 3300007188 | Bacteria | 20688 |
| 213 | Ga0127649_111176 | 3300009460 | Bacteria | 11019 |
| 214 | Ga0466705_285307 | 3300042612 | Bacteria | 25130 |
| 215 | Ga0466705_325997 | 3300042612 | Bacteria | 31796 |
| 216 | Ga0466711_421599 | 3300042615 | Bacteria | 8445 |
| 217 | Ga0466723_019869 | 3300042618 | Bacteria | 35706 |
| 218 | Ga0466723_084643 | 3300042618 | Bacteria | 11167 |
| 219 | Ga0466723_270711 | 3300042618 | Unclassified | 1105 |
| 220 | Ga0466723_320970 | 3300042618 | Bacteria | 20368 |
| 221 | Ga0466726_297587 | 3300042619 | Bacteria | 63456 |
| 222 | Ga0466734_050822 | 3300042623 | Bacteria | 4948 |
| 223 | Ga0466734_098414 | 3300042623 | Bacteria | 1685 |
| 224 | Ga0466704_560878 | 3300042643 | Bacteria | 95513 |
| 225 | Ga0466708_406796 | 3300042652 | Bacteria | 2732 |
| 226 | Ga0466725_002994 | 3300042654 | Unclassified | 2727 |
| 227 | Ga0157631_129073 | 3300013007 | Bacteria | 3269 |
| 228 | Ga0316159_10117 | 3300030930 | Bacteria | 13568 |
| 229 | Ga0415639_088021 | 3300038395 | Bacteria | 2674 |
| 230 | Ga0466690_069171 | 3300042590 | Bacteria | 11942 |
| 231 | Ga0466690_343829 | 3300042590 | Bacteria | 1255 |
| 232 | Ga0466693_424316 | 3300042592 | Bacteria | 2077 |
| 233 | Ga0466691_086087 | 3300042593 | Bacteria | 16066 |
| 234 | Ga0466714_074198 | 3300042603 | Bacteria | 829090 |
| 235 | Ga0466716_156318 | 3300042605 | Bacteria | 16709 |
| 236 | Ga0466719_066979 | 3300042606 | Bacteria | 1627 |
| 237 | Ga0123355_10155877 | 3300009826 | Bacteria | 3455 |
| 238 | Ga0123355_10193748 | 3300009826 | Bacteria | 2986 |
| 239 | Ga0123355_10417830 | 3300009826 | Bacteria | 1716 |
| 240 | Ga0123355_11941480 | 3300009826 | Unclassified | 548 |
| 241 | Ga0123356_12539287 | 3300010049 | Bacteria | 641 |
| 242 | Ga0123353_10003075 | 3300010167 | Bacteria | 20893 |
| 243 | Ga0123353_10391441 | 3300010167 | Bacteria | 2073 |
| 244 | Ga0160442_101440 | 3300012806 | Bacteria | 2884 |
| 245 | AglaG_contig18834 | 2084038013 | Bacteria | 1255 |
| 246 | JGI24700J35501_10871056 | 3300002508 | Unclassified | 2253 |
| 247 | CVPL010L_1000030 | 3300002932 | Bacteria | 49452 |
| 248 | Ga0102733_107356 | 3300006995 | Bacteria | 695 |
| 249 | Ga0103266_1000081 | 3300007067 | Bacteria | 50198 |
| 250 | Ga0103264_1000724 | 3300007188 | Bacteria | 15524 |
| 251 | Ga0103268_1034852 | 3300007192 | Unclassified | 1205 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00203 | Ribosomal_S19 | Ribosomal protein S19 | 3 | 84 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.