Protein Family IF01042
Metagenome
Isolate
582
Members
381
Samples
304
Scaffolds
143.3
Avg Length
Representative Sequence
- ID
- 3300002934|CVPL005W_1039680|CVPL005W_10396802
- Length
- 158 aa
- Sequence
- MGSFYKRLHPDKRTLMAKKVVGYIKLQVKAGQANPSPPVGPALGQRGLNIMEFCKAFNAATQKLEPGLPIPVVITAYSDRTFTFITKTPPATILLKKAAGITSGSKRPNTEKVGKVTQAQLEDIAKAKEPDLTAADLAAAVRTIAGSARSMGLTVEG*
Sample Types
Isolate
47.8%
Metagenome
52.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
28.0%
Coreidae
21.5%
Unclassified
10.8%
Termitidae
8.1%
Drosophilidae
6.2%
Formicidae
4.3%
Elmidae
4.0%
Kalotermitidae
3.8%
Culicidae
3.0%
Sarcophagidae
1.6%
Armadillidiidae
1.3%
Rhinotermitidae
1.1%
Termopsidae
1.1%
Hydrophilidae
0.8%
Curculionidae
0.8%
Passalidae
0.5%
Berytidae
0.5%
Largidae
0.5%
Alydidae
0.5%
Hodotermitidae
0.3%
Cerambycidae
0.3%
Nymphalidae
0.3%
Cixiidae
0.3%
Ixodidae
0.3%
Crambidae
0.3%
Taxonomy
Archaea
0
Bacteria
507
Eukaryota
0
Viruses
0
Unclassified
75
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 2 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 3 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 4 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 5 | 2834165886 | Saccharibacter sp. M18 | Isolate | Apidae |
| 6 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 7 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 8 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 9 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 10 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 11 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 12 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 13 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 14 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 15 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 16 | 2901819457 | Bombella sp. ESL0385 | Isolate | Apidae |
| 17 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 18 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 21 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 24 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 25 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 26 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 27 | 3300009458 | Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 32 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 33 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 41 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 42 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 43 | 8074882376 | Commensalibacter sp. M0270 | Isolate | Apidae |
| 44 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 45 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 46 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 47 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 48 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 49 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 50 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 51 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 52 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 53 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 54 | 2609460328 | Candidatus Hepatobacter penaei NHPB | Isolate | Unclassified |
| 55 | 2617271320 | Acetobacter pomorum DmCS_004 | Isolate | Drosophilidae |
| 56 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 57 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 58 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 59 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 60 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 61 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 62 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 63 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 64 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 65 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 66 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 67 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 68 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 69 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 70 | 2891675627 | Commensalibacter melissae ESL0366 | Isolate | Apidae |
| 71 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 72 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 73 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 74 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 75 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 76 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 77 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 78 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 79 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 80 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 81 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 82 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 83 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 84 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 85 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 86 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 87 | 8074832014 | Commensalibacter melissae M0391 | Isolate | Apidae |
| 88 | 8074875073 | Commensalibacter sp. M0265 | Isolate | Apidae |
| 89 | 8074878724 | Commensalibacter sp. M0267 | Isolate | Apidae |
| 90 | 8074880551 | Commensalibacter sp. M0268 | Isolate | Apidae |
| 91 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 92 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 93 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 94 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 95 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 96 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 97 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 98 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 99 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 100 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 101 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 102 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 103 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 104 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 105 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 106 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 107 | 2843864159 | Acetobacter pomorum SH | Isolate | Drosophilidae |
| 108 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 109 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 110 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 111 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 112 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 113 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 114 | 2884203697 | Commensalibacter melissae ESL0284 | Isolate | Apidae |
| 115 | 2891591111 | Commensalibacter sp. ESL0382 | Isolate | Unclassified |
| 116 | 2891610497 | Commensalibacter melissae ESL0367 | Isolate | Apidae |
| 117 | 2920412021 | Bombella sp. ESL0387 | Isolate | Apidae |
| 118 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 119 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 120 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 121 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 122 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 123 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 124 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 125 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 126 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 127 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 128 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 129 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 130 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 131 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 132 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 133 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 134 | 651324000 | Acetobacter pomorum DM001 | Isolate | Drosophilidae |
| 135 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 136 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 137 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 138 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 139 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 140 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 141 | 8074809037 | Bombella apis MRM1 | Isolate | Apidae |
| 142 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 143 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 144 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 145 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 146 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 147 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 148 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 149 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 150 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 151 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 152 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 153 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 154 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 155 | 2775507278 | Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 | Isolate | Nymphalidae |
| 156 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 157 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 158 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 159 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 160 | 2834143536 | Parasaccharibacter apium AS1 | Isolate | Apidae |
| 161 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 162 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 163 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 164 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 165 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 166 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 167 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 168 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 169 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 170 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 171 | 2899194184 | Bombella sp. ESL0378 | Isolate | Apidae |
| 172 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 173 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 174 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 175 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 176 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 177 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 178 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 179 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 180 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 181 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 182 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 183 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 184 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 185 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 186 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 187 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 188 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 189 | 8074745029 | Commensalibacter melissae M0407 | Isolate | Apidae |
| 190 | 8074748739 | Commensalibacter sp. W8133 | Isolate | Apidae |
| 191 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 192 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 193 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 194 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 195 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 196 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 197 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 198 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 199 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 200 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 201 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 202 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 203 | 2756170209 | Commensalibacter sp. ESL0284 | Isolate | Unclassified |
| 204 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 205 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 206 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 207 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 208 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 209 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 210 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 211 | 2858119979 | Acetobacter malorum DsW_057 | Isolate | Drosophilidae |
| 212 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 213 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 214 | 2891690481 | Commensalibacter melissae ESL0390 | Isolate | Apidae |
| 215 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 216 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 217 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 218 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 219 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 220 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 221 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 222 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 223 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 224 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 225 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 226 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 227 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 228 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 229 | 8074746876 | Commensalibacter sp. W6292M3 | Isolate | Apidae |
| 230 | 8074750600 | Commensalibacter sp. W8163 | Isolate | Apidae |
| 231 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 232 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 233 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 234 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 235 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 236 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 237 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 238 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 239 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 240 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 241 | 2833052049 | Commensalibacter melissae AMU001 | Isolate | Apidae |
| 242 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 243 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 244 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 245 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 246 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 247 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 248 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 249 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 250 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 251 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 252 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 253 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 254 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 255 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 256 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 257 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 258 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 259 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 260 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 261 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 262 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 263 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 264 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 265 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 266 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 267 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 268 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 269 | 8074810961 | Bombella apis SME1 | Isolate | Apidae |
| 270 | 8074871419 | Commensalibacter sp. M0133 | Isolate | Apidae |
| 271 | 8074884171 | Commensalibacter sp. M0355 | Isolate | Apidae |
| 272 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 273 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 274 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 275 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 276 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 277 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 278 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 279 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 280 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 281 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 282 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 283 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 284 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 285 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 286 | 2786546124 | Acetobacter sp. JWB | Isolate | Drosophilidae |
| 287 | 2820093073 | Unclassified Proteobacteria Lab288P3bin233 | Isolate | Unclassified |
| 288 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 289 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 290 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 291 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 292 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 293 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 294 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 295 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 296 | 2854520951 | Acetobacter pasteurianus AD | Isolate | Unclassified |
| 297 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 298 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 299 | 2858102877 | Acetobacter orientalis DmW_048 | Isolate | Drosophilidae |
| 300 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 301 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 302 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 303 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 304 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 305 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 306 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 307 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 308 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 309 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 310 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 311 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 312 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 313 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 314 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 315 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 316 | 8074737057 | Commensalibacter sp. M0357 | Isolate | Apidae |
| 317 | 8074867669 | Commensalibacter sp. B14384M2 | Isolate | Apidae |
| 318 | 8074869529 | Commensalibacter sp. B14384M3 | Isolate | Apidae |
| 319 | 8074873247 | Commensalibacter sp. M0134 | Isolate | Apidae |
| 320 | 8074876897 | Commensalibacter sp. M0266 | Isolate | Apidae |
| 321 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 322 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 323 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 324 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 325 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 326 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 327 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 328 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 329 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 330 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 331 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 332 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 333 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 334 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 335 | 2751185679 | Parasaccharibacter apium G7_7_3c | Isolate | Apidae |
| 336 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 337 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 338 | 2820092068 | Unclassified Proteobacteria Lab288P3bin38 | Isolate | Unclassified |
| 339 | 2820148564 | Unclassified Proteobacteria Emb289P1bin36 | Isolate | Unclassified |
| 340 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 341 | 2831736028 | Parasaccharibacter apium A29 | Isolate | Apidae |
| 342 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 343 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 344 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 345 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 346 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 347 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 348 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 349 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 350 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 351 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 352 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 353 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 354 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 355 | 2891605396 | Commensalibacter melissae ESL0392 | Isolate | Apidae |
| 356 | 2891614855 | Commensalibacter melissae ESL0379 | Isolate | Apidae |
| 357 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 358 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 359 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 360 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 361 | 3300009471 | Microbial communities of aphids from galls on Rhus javanica in Mt Takao, Hachioji, Japan - Schlechtendalia chinensis CVD94-71 seqcov | Metagenome | |
| 362 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 363 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 364 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 365 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 366 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 367 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 368 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 369 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 370 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 371 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 372 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 373 | 8074743123 | Commensalibacter melissae M0402 | Isolate | Apidae |
| 374 | 8074812948 | Bombella apis MRM1 | Isolate | Apidae |
| 375 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 376 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 377 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 378 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 379 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 380 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 381 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | CVPL010W_10000849 | 3300002931 | Unclassified | 34339 |
| 2 | Ga0072941_1009433 | 3300005201 | Unclassified | 4744 |
| 3 | Ga0102733_103889 | 3300006995 | Unclassified | 954 |
| 4 | Ga0103263_100040 | 3300007042 | Bacteria | 31810 |
| 5 | Ga0105004_1104288 | 3300007763 | Bacteria | 1837 |
| 6 | Ga0160470_101542 | 3300012813 | Unclassified | 5385 |
| 7 | Ga0160470_101968 | 3300012813 | Bacteria | 4294 |
| 8 | Ga0160440_100376 | 3300012815 | Bacteria | 18225 |
| 9 | Ga0160472_104393 | 3300012839 | Unclassified | 2483 |
| 10 | Ga0160433_104217 | 3300012846 | Bacteria | 2355 |
| 11 | Ga0160448_101835 | 3300012854 | Unclassified | 6765 |
| 12 | Ga0160436_1007048 | 3300012861 | Unclassified | 2575 |
| 13 | Ga0466657_399702 | 3300042582 | Bacteria | 1204 |
| 14 | Ga0466690_156393 | 3300042590 | Bacteria | 1473 |
| 15 | Ga0466692_067346 | 3300042591 | Bacteria | 15619 |
| 16 | Ga0466691_039433 | 3300042593 | Unclassified | 33986 |
| 17 | Ga0466710_167540 | 3300042613 | Bacteria | 4833 |
| 18 | Ga0466715_356726 | 3300042616 | Bacteria | 3722 |
| 19 | Ga0466726_208280 | 3300042619 | Bacteria | 2717 |
| 20 | Ga0466726_279536 | 3300042619 | Bacteria | 44438 |
| 21 | Ga0466701_101009 | 3300042598 | Bacteria | 28631 |
| 22 | Ga0466717_026742 | 3300042604 | Bacteria | 1927 |
| 23 | Ga0466719_312515 | 3300042606 | Bacteria | 1346 |
| 24 | Ga0466719_359350 | 3300042606 | Bacteria | 1615 |
| 25 | Ga0466722_008510 | 3300042609 | Bacteria | 5189 |
| 26 | Ga0466703_117978 | 3300042636 | Unclassified | 2253 |
| 27 | Ga0466704_426898 | 3300042643 | Bacteria | 15642 |
| 28 | Ga0466725_007764 | 3300042654 | Bacteria | 15372 |
| 29 | Ga0123355_10415790 | 3300009826 | Bacteria | 1723 |
| 30 | Ga0123356_10367714 | 3300010049 | Bacteria | 1567 |
| 31 | Ga0123356_10804582 | 3300010049 | Bacteria | 1111 |
| 32 | Ga0123356_12806685 | 3300010049 | Bacteria | 610 |
| 33 | Ga0160454_100246 | 3300012798 | Bacteria | 52901 |
| 34 | JGI24698J34947_10282877 | 3300002449 | Bacteria | 605 |
| 35 | Ga0068302_10464553 | 3300005071 | Bacteria | 2233 |
| 36 | Ga0102735_1000025 | 3300007080 | Bacteria | 93479 |
| 37 | Ga0102735_1045349 | 3300007080 | Unclassified | 632 |
| 38 | Ga0102734_1004060 | 3300007129 | Bacteria | 3293 |
| 39 | Ga0103264_1059523 | 3300007188 | Bacteria | 2476 |
| 40 | Ga0160470_102120 | 3300012813 | Bacteria | 4002 |
| 41 | Ga0160460_102660 | 3300012845 | Unclassified | 3773 |
| 42 | Ga0160445_101268 | 3300012847 | Unclassified | 7539 |
| 43 | Ga0160434_129695 | 3300012850 | Unclassified | 778 |
| 44 | Ga0466657_394657 | 3300042582 | Bacteria | 1603 |
| 45 | Ga0466691_224406 | 3300042593 | Bacteria | 3552 |
| 46 | Ga0466696_164610 | 3300042596 | Bacteria | 4207 |
| 47 | Ga0466710_110523 | 3300042613 | Bacteria | 1081 |
| 48 | Ga0466710_180591 | 3300042613 | Bacteria | 4542 |
| 49 | Ga0466711_480069 | 3300042615 | Bacteria | 13323 |
| 50 | Ga0466711_495047 | 3300042615 | Bacteria | 4109 |
| 51 | Ga0466715_429590 | 3300042616 | Bacteria | 2264 |
| 52 | Ga0466715_543993 | 3300042616 | Bacteria | 56318 |
| 53 | Ga0466726_361554 | 3300042619 | Bacteria | 1636 |
| 54 | Ga0466701_017752 | 3300042598 | Unclassified | 1774 |
| 55 | Ga0466701_031276 | 3300042598 | Bacteria | 18234 |
| 56 | Ga0466701_095595 | 3300042598 | Bacteria | 3505 |
| 57 | Ga0466719_102463 | 3300042606 | Bacteria | 3314 |
| 58 | Ga0466734_000177 | 3300042623 | Bacteria | 3343 |
| 59 | Ga0466734_014128 | 3300042623 | Bacteria | 2288 |
| 60 | Ga0466734_030607 | 3300042623 | Bacteria | 5057 |
| 61 | Ga0466735_013626 | 3300042624 | Unclassified | 2332 |
| 62 | Ga0466703_010180 | 3300042636 | Bacteria | 106251 |
| 63 | Ga0466703_066272 | 3300042636 | Bacteria | 2797 |
| 64 | Ga0466703_293128 | 3300042636 | Bacteria | 3218 |
| 65 | Ga0466703_362839 | 3300042636 | Bacteria | 7758 |
| 66 | Ga0466704_257157 | 3300042643 | Bacteria | 72171 |
| 67 | Ga0466704_424637 | 3300042643 | Unclassified | 16826 |
| 68 | Ga0123354_10029375 | 3300010882 | Bacteria | 8650 |
| 69 | IMNBL1DRAFT_c0079840 | 3300000062 | Bacteria | 920 |
| 70 | SCG598O02_12469 | 3300000460 | Bacteria | 9429 |
| 71 | JGI24702J35022_10051147 | 3300002462 | Bacteria | 2202 |
| 72 | CVPL010W_10031363 | 3300002931 | Unclassified | 2071 |
| 73 | CVPL005W_1039680 | 3300002934 | Bacteria | 1169 |
| 74 | Ga0072941_1453437 | 3300005201 | Bacteria | 3412 |
| 75 | Ga0103263_100681 | 3300007042 | Unclassified | 4622 |
| 76 | Ga0102736_1003750 | 3300007052 | Unclassified | 2141 |
| 77 | Ga0102734_1000169 | 3300007129 | Bacteria | 22092 |
| 78 | Ga0102734_1006657 | 3300007129 | Bacteria | 6039 |
| 79 | Ga0103268_1000160 | 3300007192 | Unclassified | 22132 |
| 80 | Ga0105005_1284807 | 3300007505 | Bacteria | 1659 |
| 81 | Ga0160470_100549 | 3300012813 | Bacteria | 14413 |
| 82 | Ga0160440_100144 | 3300012815 | Unclassified | 67802 |
| 83 | Ga0160459_108282 | 3300012831 | Unclassified | 1286 |
| 84 | Ga0160446_104825 | 3300012835 | Bacteria | 1976 |
| 85 | Ga0160448_107489 | 3300012854 | Unclassified | 2603 |
| 86 | Ga0466657_069866 | 3300042582 | Bacteria | 1784 |
| 87 | Ga0466693_362223 | 3300042592 | Unclassified | 1473 |
| 88 | Ga0466695_093256 | 3300042595 | Unclassified | 2527 |
| 89 | Ga0466701_004357 | 3300042598 | Bacteria | 5056 |
| 90 | Ga0466710_016946 | 3300042613 | Bacteria | 6618 |
| 91 | Ga0466711_023181 | 3300042615 | Bacteria | 3320 |
| 92 | Ga0466715_500137 | 3300042616 | Bacteria | 59788 |
| 93 | Ga0466734_059648 | 3300042623 | Bacteria | 14587 |
| 94 | Ga0466703_259665 | 3300042636 | Bacteria | 21129 |
| 95 | Ga0466704_068158 | 3300042643 | Bacteria | 8115 |
| 96 | Ga0466725_034927 | 3300042654 | Bacteria | 18676 |
| 97 | Ga0466727_245442 | 3300042655 | Bacteria | 20970 |
| 98 | Ga0123356_10008468 | 3300010049 | Bacteria | 10226 |
| 99 | Ga0123356_10102945 | 3300010049 | Bacteria | 2742 |
| 100 | Ga0123354_10054798 | 3300010882 | Bacteria | 5977 |
| 101 | JGI24705J35276_12234614 | 3300002504 | Unclassified | 5677 |
| 102 | CVPL005W_1008997 | 3300002934 | Bacteria | 1673 |
| 103 | Ga0074278_139416 | 3300005721 | Bacteria | 58469 |
| 104 | Ga0102733_101572 | 3300006995 | Unclassified | 1419 |
| 105 | Ga0103261_1000063 | 3300007083 | Bacteria | 38196 |
| 106 | Ga0102734_1000792 | 3300007129 | Unclassified | 8454 |
| 107 | Ga0102734_1003327 | 3300007129 | Unclassified | 3653 |
| 108 | Ga0102734_1013590 | 3300007129 | Bacteria | 3467 |
| 109 | Ga0102737_1001558 | 3300007142 | Bacteria | 6802 |
| 110 | Ga0103264_1000005 | 3300007188 | Bacteria | 151532 |
| 111 | Ga0103264_1002413 | 3300007188 | Bacteria | 8418 |
| 112 | Ga0103264_1003274 | 3300007188 | Bacteria | 7450 |
| 113 | Ga0127646_100058 | 3300009458 | Bacteria | 571963 |
| 114 | Ga0160452_100779 | 3300012834 | Unclassified | 14544 |
| 115 | Ga0265387_1005003 | 3300024582 | Bacteria | 1792 |
| 116 | Ga0466657_019139 | 3300042582 | Bacteria | 2649 |
| 117 | Ga0466692_099727 | 3300042591 | Bacteria | 7911 |
| 118 | Ga0466691_033684 | 3300042593 | Bacteria | 25218 |
| 119 | Ga0466691_182768 | 3300042593 | Bacteria | 1012 |
| 120 | Ga0466695_098397 | 3300042595 | Bacteria | 1714 |
| 121 | Ga0466705_442199 | 3300042612 | Bacteria | 2203 |
| 122 | Ga0466710_337695 | 3300042613 | Bacteria | 15779 |
| 123 | Ga0466715_474414 | 3300042616 | Bacteria | 2139 |
| 124 | Ga0466726_336815 | 3300042619 | Bacteria | 12910 |
| 125 | Ga0466728_328196 | 3300042620 | Bacteria | 2899 |
| 126 | Ga0466729_053965 | 3300042621 | Bacteria | 4381 |
| 127 | Ga0466706_164203 | 3300042599 | Bacteria | 20884 |
| 128 | Ga0466706_166831 | 3300042599 | Unclassified | 2639 |
| 129 | Ga0466707_116472 | 3300042601 | Bacteria | 15218 |
| 130 | Ga0466714_112582 | 3300042603 | Bacteria | 84178 |
| 131 | Ga0466716_024310 | 3300042605 | Unclassified | 2108 |
| 132 | Ga0466719_260588 | 3300042606 | Bacteria | 1856 |
| 133 | Ga0466719_337375 | 3300042606 | Bacteria | 15916 |
| 134 | Ga0466729_255646 | 3300042621 | Bacteria | 18595 |
| 135 | Ga0466735_093295 | 3300042624 | Unclassified | 1831 |
| 136 | Ga0466730_006253 | 3300042625 | Bacteria | 78518 |
| 137 | Ga0466730_046331 | 3300042625 | Bacteria | 6809 |
| 138 | Ga0466703_123845 | 3300042636 | Bacteria | 2922 |
| 139 | Ga0466703_130812 | 3300042636 | Bacteria | 6349 |
| 140 | Ga0466703_273862 | 3300042636 | Bacteria | 5773 |
| 141 | Ga0466703_345846 | 3300042636 | Bacteria | 7894 |
| 142 | Ga0466703_354767 | 3300042636 | Unclassified | 1539 |
| 143 | Ga0466703_400736 | 3300042636 | Bacteria | 3253 |
| 144 | Ga0466704_325180 | 3300042643 | Bacteria | 25783 |
| 145 | Ga0466724_20930 | 3300042649 | Bacteria | 8517 |
| 146 | Ga0466708_090892 | 3300042652 | Bacteria | 12888 |
| 147 | Ga0466708_118129 | 3300042652 | Bacteria | 25475 |
| 148 | Ga0466725_045645 | 3300042654 | Bacteria | 18820 |
| 149 | Ga0466725_087349 | 3300042654 | Bacteria | 25586 |
| 150 | Ga0466725_277635 | 3300042654 | Unclassified | 3497 |
| 151 | Ga0123357_10007607 | 3300009784 | Bacteria | 13417 |
| 152 | Ga0123353_10006445 | 3300010167 | Unclassified | 15620 |
| 153 | Ga0123353_10068345 | 3300010167 | Bacteria | 5705 |
| 154 | Ga0123353_11163793 | 3300010167 | Unclassified | 1016 |
| 155 | Ga0160470_100076 | 3300012813 | Bacteria | 133554 |
| 156 | AglaG_contig19401 | 2084038013 | Unclassified | 894 |
| 157 | JGI24702J35022_10038798 | 3300002462 | Bacteria | 2542 |
| 158 | JGI24696J40584_12873996 | 3300002834 | Unclassified | 1057 |
| 159 | CVPL010W_10007946 | 3300002931 | Bacteria | 10343 |
| 160 | Ga0068302_10168629 | 3300005071 | Unclassified | 2150 |
| 161 | Ga0102739_1000012 | 3300007095 | Bacteria | 68645 |
| 162 | Ga0102738_1000044 | 3300007141 | Bacteria | 91568 |
| 163 | Ga0103264_1000132 | 3300007188 | Bacteria | 42832 |
| 164 | Ga0103264_1000374 | 3300007188 | Unclassified | 23636 |
| 165 | Ga0123357_10000675 | 3300009784 | Bacteria | 34067 |
| 166 | Ga0160440_100397 | 3300012815 | Bacteria | 16625 |
| 167 | Ga0160432_103334 | 3300012818 | Bacteria | 2487 |
| 168 | Ga0160433_104753 | 3300012846 | Unclassified | 2142 |
| 169 | Ga0160447_106845 | 3300012849 | Unclassified | 2951 |
| 170 | Ga0466656_115043 | 3300042550 | Bacteria | 2648 |
| 171 | Ga0466690_427016 | 3300042590 | Bacteria | 17189 |
| 172 | Ga0466691_033020 | 3300042593 | Bacteria | 12694 |
| 173 | Ga0466691_125132 | 3300042593 | Bacteria | 17265 |
| 174 | Ga0466696_305662 | 3300042596 | Bacteria | 2254 |
| 175 | Ga0466705_503987 | 3300042612 | Bacteria | 16414 |
| 176 | Ga0466728_014035 | 3300042620 | Bacteria | 5754 |
| 177 | Ga0466729_196921 | 3300042621 | Bacteria | 13939 |
| 178 | Ga0466713_073082 | 3300042602 | Bacteria | 8444 |
| 179 | Ga0466719_101988 | 3300042606 | Unclassified | 3494 |
| 180 | Ga0466734_065122 | 3300042623 | Bacteria | 2722 |
| 181 | Ga0466703_296419 | 3300042636 | Bacteria | 105385 |
| 182 | Ga0466724_24769 | 3300042649 | Unclassified | 8477 |
| 183 | Ga0466708_242005 | 3300042652 | Bacteria | 2537 |
| 184 | Ga0466708_286945 | 3300042652 | Bacteria | 21461 |
| 185 | Ga0466708_407205 | 3300042652 | Bacteria | 13399 |
| 186 | Ga0466725_011797 | 3300042654 | Unclassified | 10640 |
| 187 | Ga0123357_10045950 | 3300009784 | Bacteria | 5923 |
| 188 | Ga0123357_10215734 | 3300009784 | Unclassified | 2143 |
| 189 | Ga0123353_10000118 | 3300010167 | Bacteria | 93515 |
| 190 | Ga0123353_10212505 | 3300010167 | Bacteria | 3033 |
| 191 | Ga0123354_10006260 | 3300010882 | Bacteria | 17634 |
| 192 | HBC_ctgsDRAFT_1082764 | 3300000333 | Bacteria | 758 |
| 193 | JGI24705J35276_12228200 | 3300002504 | Bacteria | 3143 |
| 194 | JGI24699J35502_10973104 | 3300002509 | Bacteria | 1243 |
| 195 | CVPL010W_10001797 | 3300002931 | Unclassified | 25263 |
| 196 | CVPL005W_1002456 | 3300002934 | Unclassified | 3608 |
| 197 | CVPL005L_10000306 | 3300002938 | Bacteria | 48097 |
| 198 | Ga0103264_1004228 | 3300007188 | Bacteria | 6738 |
| 199 | Ga0105008_1227777 | 3300007507 | Bacteria | 1156 |
| 200 | Ga0160456_100361 | 3300012820 | Bacteria | 16519 |
| 201 | Ga0160467_103117 | 3300012829 | Unclassified | 3016 |
| 202 | Ga0160435_1001475 | 3300012857 | Unclassified | 5962 |
| 203 | Ga0466656_367314 | 3300042550 | Bacteria | 2570 |
| 204 | Ga0466657_108160 | 3300042582 | Bacteria | 16433 |
| 205 | Ga0466690_019836 | 3300042590 | Bacteria | 6253 |
| 206 | Ga0466691_093506 | 3300042593 | Bacteria | 1730 |
| 207 | Ga0466710_133064 | 3300042613 | Bacteria | 70935 |
| 208 | Ga0466710_174796 | 3300042613 | Bacteria | 5110 |
| 209 | Ga0466715_168909 | 3300042616 | Bacteria | 2268 |
| 210 | Ga0466726_197069 | 3300042619 | Bacteria | 12655 |
| 211 | Ga0466701_071155 | 3300042598 | Bacteria | 16610 |
| 212 | Ga0466706_029080 | 3300042599 | Bacteria | 3413 |
| 213 | Ga0466717_024755 | 3300042604 | Bacteria | 1776 |
| 214 | Ga0466717_137420 | 3300042604 | Bacteria | 2618 |
| 215 | Ga0466719_038642 | 3300042606 | Bacteria | 30948 |
| 216 | Ga0466722_129668 | 3300042609 | Bacteria | 5075 |
| 217 | Ga0466729_205290 | 3300042621 | Bacteria | 1302 |
| 218 | Ga0466734_027860 | 3300042623 | Bacteria | 15735 |
| 219 | Ga0466734_134844 | 3300042623 | Bacteria | 4626 |
| 220 | Ga0466735_122292 | 3300042624 | Bacteria | 2396 |
| 221 | Ga0466703_187724 | 3300042636 | Unclassified | 8367 |
| 222 | Ga0466703_259944 | 3300042636 | Bacteria | 27101 |
| 223 | Ga0466724_36307 | 3300042649 | Bacteria | 158990 |
| 224 | Ga0466708_037621 | 3300042652 | Bacteria | 6534 |
| 225 | Ga0466725_248631 | 3300042654 | Bacteria | 15387 |
| 226 | Ga0466725_343052 | 3300042654 | Bacteria | 3866 |
| 227 | Ga0123356_10064162 | 3300010049 | Bacteria | 3433 |
| 228 | Ga0123354_10112839 | 3300010882 | Bacteria | 3575 |
| 229 | Ga0466697_132631 | 3300042611 | Bacteria | 1280 |
| 230 | Ga0466697_182069 | 3300042611 | Bacteria | 3157 |
| 231 | Ga0466697_207452 | 3300042611 | Bacteria | 3266 |
| 232 | Ga0466733_021577 | 3300042659 | Bacteria | 12342 |
| 233 | IMNBGM34_c011506 | 3300000036 | Bacteria | 1110 |
| 234 | SCG598J21_11573 | 3300000475 | Bacteria | 13732 |
| 235 | JGI24695J34938_10116318 | 3300002450 | Bacteria | 1089 |
| 236 | JGI24705J35276_12219967 | 3300002504 | Bacteria | 2237 |
| 237 | CVPL010W_10025773 | 3300002931 | Bacteria | 2776 |
| 238 | Ga0103261_1000935 | 3300007083 | Unclassified | 4527 |
| 239 | Ga0102738_1000032 | 3300007141 | Bacteria | 69171 |
| 240 | Ga0103267_1016044 | 3300007190 | Unclassified | 3142 |
| 241 | Ga0103268_1000274 | 3300007192 | Bacteria | 18089 |
| 242 | Ga0105005_1132832 | 3300007505 | Bacteria | 2027 |
| 243 | Ga0160433_101287 | 3300012846 | Unclassified | 7313 |
| 244 | Ga0466657_312701 | 3300042582 | Bacteria | 2610 |
| 245 | Ga0466690_273225 | 3300042590 | Bacteria | 5414 |
| 246 | Ga0466691_156979 | 3300042593 | Bacteria | 2143 |
| 247 | Ga0466694_212050 | 3300042594 | Bacteria | 7321 |
| 248 | Ga0466718_117295 | 3300042617 | Unclassified | 4314 |
| 249 | Ga0466723_092983 | 3300042618 | Bacteria | 1707 |
| 250 | Ga0466723_099920 | 3300042618 | Unclassified | 5372 |
| 251 | Ga0466723_114602 | 3300042618 | Bacteria | 14245 |
| 252 | Ga0466701_060431 | 3300042598 | Bacteria | 3329 |
| 253 | Ga0466701_078915 | 3300042598 | Bacteria | 1487 |
| 254 | Ga0466706_243485 | 3300042599 | Unclassified | 1437 |
| 255 | Ga0466707_024414 | 3300042601 | Bacteria | 5147 |
| 256 | Ga0466707_080153 | 3300042601 | Bacteria | 11827 |
| 257 | Ga0466719_025208 | 3300042606 | Bacteria | 11206 |
| 258 | Ga0466719_291670 | 3300042606 | Bacteria | 7280 |
| 259 | Ga0466729_271413 | 3300042621 | Unclassified | 1092 |
| 260 | Ga0466731_050254 | 3300042622 | Unclassified | 3368 |
| 261 | Ga0466734_051758 | 3300042623 | Bacteria | 4041 |
| 262 | Ga0466730_089988 | 3300042625 | Unclassified | 2318 |
| 263 | Ga0466704_056686 | 3300042643 | Bacteria | 2394 |
| 264 | Ga0466704_571957 | 3300042643 | Bacteria | 15856 |
| 265 | Ga0466709_317854 | 3300042648 | Bacteria | 13740 |
| 266 | Ga0466708_023938 | 3300042652 | Bacteria | 11015 |
| 267 | Ga0123357_10192485 | 3300009784 | Unclassified | 2346 |
| 268 | Ga0123355_10010257 | 3300009826 | Bacteria | 14327 |
| 269 | Ga0123356_10028462 | 3300010049 | Unclassified | 5235 |
| 270 | Ga0160471_100761 | 3300012812 | Bacteria | 7755 |
| 271 | Ga0466705_233456 | 3300042612 | Bacteria | 15799 |
| 272 | CVPL005W_1000067 | 3300002934 | Bacteria | 40800 |
| 273 | Ga0102736_1004412 | 3300007052 | Unclassified | 1892 |
| 274 | Ga0102734_1000854 | 3300007129 | Bacteria | 8053 |
| 275 | Ga0102734_1021336 | 3300007129 | Bacteria | 1617 |
| 276 | Ga0102740_1000437 | 3300007140 | Unclassified | 11559 |
| 277 | Ga0127653_100020 | 3300009471 | Bacteria | 389096 |
| 278 | Ga0160457_1000525 | 3300012858 | Bacteria | 16364 |
| 279 | Ga0466656_181263 | 3300042550 | Unclassified | 1510 |
| 280 | Ga0466690_021358 | 3300042590 | Bacteria | 2667 |
| 281 | Ga0466705_453883 | 3300042612 | Bacteria | 1269 |
| 282 | Ga0466710_155272 | 3300042613 | Bacteria | 15343 |
| 283 | Ga0466710_214386 | 3300042613 | Bacteria | 1562 |
| 284 | Ga0466712_153020 | 3300042614 | Bacteria | 5647 |
| 285 | Ga0466715_043000 | 3300042616 | Unclassified | 1838 |
| 286 | Ga0466723_178420 | 3300042618 | Bacteria | 5459 |
| 287 | Ga0466700_059905 | 3300042600 | Bacteria | 4707 |
| 288 | Ga0466707_059026 | 3300042601 | Unclassified | 5649 |
| 289 | Ga0466713_068457 | 3300042602 | Bacteria | 13049 |
| 290 | Ga0466717_268666 | 3300042604 | Unclassified | 1050 |
| 291 | Ga0466719_137014 | 3300042606 | Unclassified | 2130 |
| 292 | Ga0466719_167285 | 3300042606 | Bacteria | 7182 |
| 293 | Ga0466734_018773 | 3300042623 | Unclassified | 3602 |
| 294 | Ga0466734_036214 | 3300042623 | Bacteria | 1014 |
| 295 | Ga0466730_027649 | 3300042625 | Bacteria | 3379 |
| 296 | Ga0466703_327730 | 3300042636 | Bacteria | 2172 |
| 297 | Ga0466703_418766 | 3300042636 | Bacteria | 36622 |
| 298 | Ga0466709_376990 | 3300042648 | Unclassified | 1368 |
| 299 | Ga0466709_420081 | 3300042648 | Unclassified | 14269 |
| 300 | Ga0466727_026338 | 3300042655 | Bacteria | 2674 |
| 301 | Ga0123357_10005090 | 3300009784 | Bacteria | 15663 |
| 302 | Ga0123357_10518320 | 3300009784 | Unclassified | 976 |
| 303 | Ga0123355_11716694 | 3300009826 | Unclassified | 597 |
| 304 | Ga0123356_11137008 | 3300010049 | Bacteria | 948 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.