Protein Family IF00065
Metagenome
Isolate
606
Members
516
Samples
182
Scaffolds
232.83
Avg Length
Representative Sequence
- ID
- 2100351016|SWWA_contig00757__length_6462___numreads_142|SWWA_02326740
- Length
- 249 aa
- Sequence
- MAKLTKRMRVIRDKVDATKQYDITEAVALLKELATAKFVESVDVAVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFAQGANAEAAKAAGAELVGMDDLADQIKKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKQNLLRRKACTSRKLASPPPWVLALLSIRAVCLLQRTNRICDYRFDLGPRFV
Sample Types
Isolate
70.0%
Metagenome
30.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
29.7%
Unclassified
22.6%
Drosophilidae
5.5%
Anthocoridae
4.4%
Elmidae
3.8%
Termitidae
3.4%
Curculionidae
3.2%
Muscidae
2.6%
Formicidae
2.4%
Kalotermitidae
2.4%
Tenebrionidae
2.0%
Culicidae
1.8%
Calliphoridae
1.8%
Sarcophagidae
1.4%
Aphididae
1.2%
Tephritidae
1.0%
Rhinotermitidae
0.8%
Cerambycidae
0.8%
Termopsidae
0.8%
Aleyrodidae
0.6%
Palinuridae
0.6%
Talitridae
0.6%
Pteromalidae
0.6%
Pentatomidae
0.4%
Armadillidiidae
0.4%
Majidae
0.4%
Lysianassidae
0.2%
Aphalaridae
0.2%
Daphniidae
0.2%
Aphrophoridae
0.2%
Hodotermitidae
0.2%
Reduviidae
0.2%
Rhopalidae
0.2%
Penaeidae
0.2%
Glossinidae
0.2%
Carabidae
0.2%
Scarabaeidae
0.2%
Trigoniulidae
0.2%
Nephropidae
0.2%
Stratiomyidae
0.2%
Thripidae
0.2%
Anthomyiidae
0.2%
Artemiidae
0.2%
Siricidae
0.2%
Passalidae
0.2%
Crambidae
0.2%
Pseudococcidae
0.2%
Gryllidae
0.2%
Taxonomy
Archaea
0
Bacteria
557
Eukaryota
0
Viruses
0
Unclassified
49
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 3 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 4 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 5 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 6 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 7 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 8 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 9 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 10 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 11 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 12 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 13 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 14 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 15 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 16 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 17 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 18 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 19 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 20 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 21 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 22 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 23 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 24 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 25 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 26 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 27 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 28 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 29 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 30 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 31 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 32 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 33 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 34 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 35 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 36 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 37 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 38 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 39 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 40 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 41 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 42 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 43 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 44 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 45 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 46 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 47 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 48 | 3300000472 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 | Metagenome | Apidae |
| 49 | 3300000473 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-I20 | Metagenome | Apidae |
| 50 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 51 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 52 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 53 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 54 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 55 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 56 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 57 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 58 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 59 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 60 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 61 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 62 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 63 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 64 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 65 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 66 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 67 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 68 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 69 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 70 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 71 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 72 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 73 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 74 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 75 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 76 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 77 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 78 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 79 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 80 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 81 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 82 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 83 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 84 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 85 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 86 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 87 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 88 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 89 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 90 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 91 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 92 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 93 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 94 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 95 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 96 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 97 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 98 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 99 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 100 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 101 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 102 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 103 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 104 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 105 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 106 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 107 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 108 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 109 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 110 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 111 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 112 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 113 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 114 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 115 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 116 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 117 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 118 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 119 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 120 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 121 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 122 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 123 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 124 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 125 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 126 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 127 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 128 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 129 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 130 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 131 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 132 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 133 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 134 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 135 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 136 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 137 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 138 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 139 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 140 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 141 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 142 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 143 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 144 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 145 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 146 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 147 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 148 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 149 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 150 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 151 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 152 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 153 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 154 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 155 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 156 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 157 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 158 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 159 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 160 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 161 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 162 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 163 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 164 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 165 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 166 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 167 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 168 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 169 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 170 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 171 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 172 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 173 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 174 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 175 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 176 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 177 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 178 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 179 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 180 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 181 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 182 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 183 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 184 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 185 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Apidae |
| 186 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 187 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 188 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 189 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 190 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 191 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 192 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 193 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 194 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 195 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 196 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 197 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 198 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 199 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 200 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 201 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 202 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 203 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 204 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 205 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 206 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 207 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 208 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 209 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 210 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 211 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 212 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 213 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 214 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 215 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 216 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 217 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 218 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 219 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 220 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 221 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 222 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 223 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 224 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 225 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 226 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 227 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 228 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 229 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 230 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 231 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 232 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 233 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 234 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 235 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 236 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 237 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 238 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 239 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 240 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 241 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 242 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 243 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 244 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 245 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 246 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 247 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 248 | 2958255616 | Serratia marcescens TM | Isolate | |
| 249 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 250 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 251 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 252 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 253 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 254 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 255 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 256 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 257 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 258 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 259 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 260 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 261 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 262 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 263 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 264 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 265 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 266 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 267 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 268 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 269 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 270 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 271 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 272 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 273 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 274 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 275 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 276 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 277 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 278 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 279 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 280 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 281 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 282 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 283 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 284 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 285 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 286 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 287 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 288 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 289 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 290 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 291 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 292 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 293 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 294 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 295 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 296 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 297 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 298 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 299 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 300 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 301 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 302 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 303 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 304 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 305 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 306 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 307 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 308 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 309 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 310 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 311 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 312 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 313 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 314 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 315 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 316 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 317 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 318 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 319 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 320 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 321 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 322 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 323 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 324 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 325 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 326 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 327 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 328 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 329 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 330 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 331 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 332 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 333 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 334 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 335 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 336 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 337 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 338 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 339 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 340 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 341 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 342 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 343 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 344 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 345 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 346 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 347 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 348 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 349 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 350 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 351 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 352 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 353 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 354 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 355 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 356 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 357 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 358 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 359 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 360 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 361 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 362 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 363 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 364 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 365 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 366 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 367 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 368 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 369 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 370 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 371 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 372 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 373 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 374 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 375 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 376 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 377 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 378 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 379 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 380 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 381 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 382 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 383 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 384 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 385 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 386 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 387 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 388 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 389 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 390 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 391 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 392 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 393 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 394 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 395 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 396 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 397 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 398 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 399 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 400 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 401 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 402 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 403 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 404 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 405 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 406 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 407 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 408 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 409 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 410 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 411 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 412 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 413 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 414 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 415 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 416 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 417 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 418 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 419 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 420 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 421 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 422 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 423 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 424 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 425 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 426 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 427 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 428 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 429 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 430 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 431 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 432 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 433 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 434 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 435 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 436 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 437 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 438 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 439 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 440 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 441 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 442 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 443 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 444 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 445 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 446 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 447 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 448 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 449 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 450 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 451 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 452 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 453 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 454 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 455 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 456 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 457 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 458 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 459 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 460 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 461 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 462 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 463 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 464 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 465 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 466 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 467 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 468 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 469 | 2833859439 | Arsenophonus endosymbiont of Aleurodicus dispersus ARAD | Isolate | Aleyrodidae |
| 470 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 471 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 472 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 473 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 474 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 475 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 476 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 477 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 478 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 479 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 480 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 481 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 482 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 483 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 484 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 485 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 486 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 487 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 488 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 489 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 490 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 491 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Drosophilidae |
| 492 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 493 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 494 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 495 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 496 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 497 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 498 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 499 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 500 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 501 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 502 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 503 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 504 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 505 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 506 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 507 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 508 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 509 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 510 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 511 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 512 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 513 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 514 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 515 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 516 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562378_0022 | 3300056814 | Bacteria | 672696 |
| 2 | Ga0466704_324912 | 3300042643 | Unclassified | 1161 |
| 3 | Ga0466727_026338 | 3300042655 | Bacteria | 2674 |
| 4 | Ga0466690_415645 | 3300042590 | Bacteria | 1725 |
| 5 | Ga0466692_047041 | 3300042591 | Bacteria | 13657 |
| 6 | Ga0466692_165952 | 3300042591 | Bacteria | 3488 |
| 7 | Ga0466701_005002 | 3300042598 | Bacteria | 6930 |
| 8 | Ga0123355_10118758 | 3300009826 | Bacteria | 4108 |
| 9 | Ga0466701_054507 | 3300042598 | Unclassified | 2769 |
| 10 | Ga0466707_059026 | 3300042601 | Unclassified | 5649 |
| 11 | Ga0466707_070416 | 3300042601 | Bacteria | 77540 |
| 12 | Ga0466714_012163 | 3300042603 | Bacteria | 1783 |
| 13 | Ga0466719_167285 | 3300042606 | Bacteria | 7182 |
| 14 | HBC_ctgsDRAFT_1028386 | 3300000333 | Unclassified | 1374 |
| 15 | Ga0063521_1000120 | 3300003973 | Bacteria | 59713 |
| 16 | Ga0102734_1000416 | 3300007129 | Bacteria | 12184 |
| 17 | Ga0104040_1035472 | 3300007149 | Bacteria | 3075 |
| 18 | Ga0103267_1000404 | 3300007190 | Bacteria | 14060 |
| 19 | Ga0105005_1082772 | 3300007505 | Unclassified | 2158 |
| 20 | Ga0127656_100105 | 3300009453 | Bacteria | 45606 |
| 21 | Ga0127657_111844 | 3300009457 | Bacteria | 5841 |
| 22 | Ga0466712_153020 | 3300042614 | Bacteria | 5647 |
| 23 | Ga0466723_178420 | 3300042618 | Bacteria | 5459 |
| 24 | Ga0466730_040928 | 3300042625 | Bacteria | 3887 |
| 25 | Ga0466724_05511 | 3300042649 | Unclassified | 2789 |
| 26 | Ga0466708_074047 | 3300042652 | Bacteria | 28825 |
| 27 | Ga0466708_407205 | 3300042652 | Bacteria | 13399 |
| 28 | Ga0466725_025725 | 3300042654 | Bacteria | 1527 |
| 29 | Ga0160448_100189 | 3300012854 | Unclassified | 25936 |
| 30 | Ga0466690_427016 | 3300042590 | Bacteria | 17189 |
| 31 | Ga0466691_125132 | 3300042593 | Bacteria | 17265 |
| 32 | Ga0136159_1000066 | 3300010217 | Bacteria | 97058 |
| 33 | Ga0466713_073082 | 3300042602 | Bacteria | 8444 |
| 34 | Ga0466713_114375 | 3300042602 | Unclassified | 3282 |
| 35 | Ga0466719_101988 | 3300042606 | Unclassified | 3494 |
| 36 | Ga0063521_1001404 | 3300003973 | Bacteria | 6676 |
| 37 | Ga0074309_1001975 | 3300005314 | Unclassified | 2858 |
| 38 | Ga0074188_1000785 | 3300005318 | Bacteria | 8554 |
| 39 | Ga0102733_101184 | 3300006995 | Unclassified | 1594 |
| 40 | Ga0102737_1002752 | 3300007142 | Bacteria | 4229 |
| 41 | Ga0103264_1018676 | 3300007188 | Unclassified | 3383 |
| 42 | Ga0104147_1031221 | 3300007224 | Bacteria | 10290 |
| 43 | Ga0105553_1023974 | 3300007767 | Unclassified | 14819 |
| 44 | Ga0127657_104882 | 3300009457 | Bacteria | 32634 |
| 45 | Ga0466723_113112 | 3300042618 | Bacteria | 15978 |
| 46 | Ga0466729_196921 | 3300042621 | Bacteria | 13939 |
| 47 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 48 | Ga0562377_0002 | 3300056842 | Bacteria | 4351833 |
| 49 | Ga0466734_106641 | 3300042623 | Bacteria | 3060 |
| 50 | Ga0466703_293128 | 3300042636 | Bacteria | 3218 |
| 51 | Ga0466724_31876 | 3300042649 | Unclassified | 3784 |
| 52 | Ga0160468_100575 | 3300012819 | Unclassified | 13837 |
| 53 | Ga0415639_190881 | 3300038395 | Bacteria | 1848 |
| 54 | Ga0123356_10041924 | 3300010049 | Unclassified | 4265 |
| 55 | Ga0466701_095595 | 3300042598 | Bacteria | 3505 |
| 56 | Ga0466719_102463 | 3300042606 | Bacteria | 3314 |
| 57 | gam1t_NODE_697774_length=10685_GC=35_1_Contigs=7 | 2189573031 | Bacteria | 10745 |
| 58 | SCG598O11_12230 | 3300000471 | Bacteria | 107509 |
| 59 | SCG598L16_134585 | 3300000490 | Bacteria | 40638 |
| 60 | CVPL005W_1000638 | 3300002934 | Unclassified | 12612 |
| 61 | Ga0068302_10464553 | 3300005071 | Bacteria | 2233 |
| 62 | Ga0074302_1033331 | 3300005316 | Bacteria | 3291 |
| 63 | Ga0103266_1000120 | 3300007067 | Bacteria | 38540 |
| 64 | Ga0104040_1142496 | 3300007149 | Unclassified | 2709 |
| 65 | Ga0466726_370927 | 3300042619 | Bacteria | 1140 |
| 66 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 67 | Ga0466730_027359 | 3300042625 | Bacteria | 2139 |
| 68 | Ga0466704_254314 | 3300042643 | Bacteria | 1281 |
| 69 | Ga0466709_215386 | 3300042648 | Bacteria | 5842 |
| 70 | Ga0466724_58247 | 3300042649 | Unclassified | 13637 |
| 71 | Ga0466708_090892 | 3300042652 | Bacteria | 12888 |
| 72 | Ga0466725_087349 | 3300042654 | Bacteria | 25586 |
| 73 | Ga0265387_1000220 | 3300024582 | Unclassified | 9816 |
| 74 | Ga0466657_019139 | 3300042582 | Bacteria | 2649 |
| 75 | Ga0466692_099727 | 3300042591 | Bacteria | 7911 |
| 76 | Ga0123357_10007607 | 3300009784 | Bacteria | 13417 |
| 77 | Ga0123353_10006445 | 3300010167 | Unclassified | 15620 |
| 78 | Ga0466701_051034 | 3300042598 | Bacteria | 2764 |
| 79 | Ga0466707_116472 | 3300042601 | Bacteria | 15218 |
| 80 | Ga0466707_215871 | 3300042601 | Bacteria | 2831 |
| 81 | Ga0466719_337375 | 3300042606 | Bacteria | 15916 |
| 82 | SPBB_contig11642 | 2044078006 | Unclassified | 8416 |
| 83 | FGTW_contig30635 | 2065487013 | Unclassified | 13028 |
| 84 | SCG598B02_11437 | 3300000472 | Bacteria | 26544 |
| 85 | Meta3P_1002997 | 3300002464 | Unclassified | 1182 |
| 86 | Ga0104044_1153011 | 3300007136 | Unclassified | 890 |
| 87 | Ga0103267_1007438 | 3300007190 | Bacteria | 3187 |
| 88 | Ga0466726_336815 | 3300042619 | Bacteria | 12910 |
| 89 | Ga0466729_053965 | 3300042621 | Bacteria | 4381 |
| 90 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 91 | Ga0466735_122292 | 3300042624 | Bacteria | 2396 |
| 92 | Ga0466730_031310 | 3300042625 | Bacteria | 150332 |
| 93 | Ga0466703_259944 | 3300042636 | Bacteria | 27101 |
| 94 | Ga0466724_36307 | 3300042649 | Bacteria | 158990 |
| 95 | Ga0466708_010991 | 3300042652 | Bacteria | 11017 |
| 96 | Ga0466725_020645 | 3300042654 | Unclassified | 1428 |
| 97 | Ga0160441_111273 | 3300012825 | Unclassified | 1052 |
| 98 | Ga0466657_108160 | 3300042582 | Bacteria | 16433 |
| 99 | Ga0466690_019836 | 3300042590 | Bacteria | 6253 |
| 100 | Ga0123356_10064162 | 3300010049 | Bacteria | 3433 |
| 101 | Ga0466706_029080 | 3300042599 | Bacteria | 3413 |
| 102 | Ga0466713_053525 | 3300042602 | Unclassified | 3289 |
| 103 | Ga0466719_486193 | 3300042606 | Bacteria | 1498 |
| 104 | Ga0466722_129668 | 3300042609 | Bacteria | 5075 |
| 105 | SWWA_contig31944__length_3424___numreads_200 | 2100351016 | Bacteria | 3424 |
| 106 | Ga0068305_10306353 | 3300005083 | Unclassified | 1473 |
| 107 | Ga0074278_107915 | 3300005721 | Bacteria | 8064 |
| 108 | Ga0104049_1137921 | 3300007103 | Bacteria | 992 |
| 109 | Ga0104041_1032452 | 3300007106 | Bacteria | 11314 |
| 110 | Ga0104019_1189993 | 3300007150 | Bacteria | 3024 |
| 111 | Ga0105005_1082509 | 3300007505 | Unclassified | 7768 |
| 112 | Ga0105005_1278873 | 3300007505 | Bacteria | 2299 |
| 113 | Ga0105524_102375 | 3300007733 | Bacteria | 5956 |
| 114 | Ga0127524_178098 | 3300009478 | Bacteria | 1164 |
| 115 | Ga0466710_094963 | 3300042613 | Bacteria | 1848 |
| 116 | Ga0466710_174796 | 3300042613 | Bacteria | 5110 |
| 117 | Ga0466715_168909 | 3300042616 | Bacteria | 2268 |
| 118 | Ga0466715_188360 | 3300042616 | Bacteria | 4144 |
| 119 | Ga0466726_197069 | 3300042619 | Bacteria | 12655 |
| 120 | Ga0466697_182069 | 3300042611 | Bacteria | 3157 |
| 121 | Ga0466733_021577 | 3300042659 | Bacteria | 12342 |
| 122 | Ga0466730_008492 | 3300042625 | Bacteria | 6038 |
| 123 | Ga0466730_067021 | 3300042625 | Unclassified | 5696 |
| 124 | Ga0160448_128272 | 3300012854 | Unclassified | 833 |
| 125 | Ga0160435_1003941 | 3300012857 | Unclassified | 3472 |
| 126 | Ga0466657_312701 | 3300042582 | Bacteria | 2610 |
| 127 | Ga0466690_273225 | 3300042590 | Bacteria | 5414 |
| 128 | Ga0466701_041583 | 3300042598 | Bacteria | 9889 |
| 129 | Ga0466701_060431 | 3300042598 | Bacteria | 3329 |
| 130 | Ga0466707_032892 | 3300042601 | Bacteria | 15973 |
| 131 | Ga0466717_305513 | 3300042604 | Bacteria | 1446 |
| 132 | Ga0466719_025208 | 3300042606 | Bacteria | 11206 |
| 133 | Ga0466719_291670 | 3300042606 | Bacteria | 7280 |
| 134 | SWWA_contig00757__length_6462___numreads_142 | 2100351016 | Bacteria | 6462 |
| 135 | HBC_ctgsDRAFT_1013439 | 3300000333 | Unclassified | 1971 |
| 136 | SCG598I20_11809 | 3300000473 | Unclassified | 10125 |
| 137 | Ga0063521_1020345 | 3300003973 | Unclassified | 1599 |
| 138 | Ga0102734_1003151 | 3300007129 | Bacteria | 7255 |
| 139 | Ga0104050_1003526 | 3300007153 | Bacteria | 2506 |
| 140 | Ga0103267_1008156 | 3300007190 | Bacteria | 3085 |
| 141 | Ga0466726_132207 | 3300042619 | Bacteria | 4741 |
| 142 | Ga0466705_352026 | 3300042612 | Bacteria | 6215 |
| 143 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 144 | Ga0466704_591825 | 3300042643 | Unclassified | 4044 |
| 145 | Ga0466724_12131 | 3300042649 | Unclassified | 3029 |
| 146 | Ga0160441_111256 | 3300012825 | Unclassified | 1053 |
| 147 | Ga0160433_101543 | 3300012846 | Unclassified | 6148 |
| 148 | Ga0466657_375608 | 3300042582 | Bacteria | 3714 |
| 149 | Ga0123356_10360445 | 3300010049 | Bacteria | 1581 |
| 150 | Ga0466719_359350 | 3300042606 | Bacteria | 1615 |
| 151 | SPBB_contig11649 | 2044078006 | Unclassified | 6774 |
| 152 | gam1t_NODE_392340_length=7081_GC=35_6_Contigs=2 | 2189573031 | Unclassified | 7091 |
| 153 | HBC_ctgsDRAFT_1015445 | 3300000333 | Unclassified | 1850 |
| 154 | WW0001_100081 | 3300002732 | Bacteria | 214513 |
| 155 | Ga0063521_1000313 | 3300003973 | Bacteria | 29434 |
| 156 | Ga0104041_1124134 | 3300007106 | Unclassified | 903 |
| 157 | Ga0466715_356726 | 3300042616 | Bacteria | 3722 |
| 158 | Ga0466705_353242 | 3300042612 | Bacteria | 39923 |
| 159 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 160 | Ga0466734_059648 | 3300042623 | Bacteria | 14587 |
| 161 | Ga0466704_068158 | 3300042643 | Bacteria | 8115 |
| 162 | Ga0466724_33061 | 3300042649 | Bacteria | 10924 |
| 163 | Ga0466725_034927 | 3300042654 | Bacteria | 18676 |
| 164 | Ga0466727_245442 | 3300042655 | Bacteria | 20970 |
| 165 | Ga0316159_10002 | 3300030930 | Bacteria | 247683 |
| 166 | Ga0123355_10416996 | 3300009826 | Bacteria | 1719 |
| 167 | Ga0466701_044424 | 3300042598 | Bacteria | 22119 |
| 168 | FGTW_contig30737 | 2065487013 | Unclassified | 10134 |
| 169 | gam1t_NODE_593770_length=43570_GC=36_1_Contigs=1 | 2189573031 | Bacteria | 43570 |
| 170 | 2227302991 | 2225789004 | Bacteria | 30056 |
| 171 | HBC_ctgsDRAFT_1000273 | 3300000333 | Bacteria | 11948 |
| 172 | Ga0074302_1031568 | 3300005316 | Unclassified | 906 |
| 173 | Ga0103265_1002939 | 3300007068 | Unclassified | 2577 |
| 174 | Ga0102735_1000021 | 3300007080 | Bacteria | 54507 |
| 175 | Ga0102740_1003849 | 3300007140 | Unclassified | 3099 |
| 176 | Ga0103267_1000596 | 3300007190 | Unclassified | 10548 |
| 177 | Ga0103268_1000203 | 3300007192 | Bacteria | 32563 |
| 178 | Ga0466710_016946 | 3300042613 | Bacteria | 6618 |
| 179 | Ga0466711_023181 | 3300042615 | Bacteria | 3320 |
| 180 | Ga0466711_177147 | 3300042615 | Bacteria | 7473 |
| 181 | Ga0466711_424242 | 3300042615 | Bacteria | 4850 |
| 182 | Ga0466728_117967 | 3300042620 | Bacteria | 18009 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00687 | Ribosomal_L1 | Ribosomal protein L1p/L10e family | 30 | 199 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.