Metagenome / Metatranscriptome Family F002654

Basic Information
Family ID	F002654
Family Type	Metagenome / Metatranscriptome
Number of Sequences	539
Average Sequence Length	46 residues
Representative Sequence	LNYQTFNDKVVCQKGNSPEQVFKVPKFLLSESKEVFKLYNQEIGLEAAIF
Number of Associated Samples	411
Number of Associated Scaffolds	539

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	39.15 %
% of genes near scaffold ends (potentially truncated)	74.40 %
% of genes from short scaffolds (< 2000 bps)	90.72 %
Associated GOLD sequencing projects	392
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.22

Most Common Taxonomy
Group	Eukaryota (82.560 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (15.213 % of family members)
Environment Ontology (ENVO)	Unclassified (28.757 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (33.952 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 30.77% β-sheet: 0.00% Coil/Unstructured: 69.23%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 539 Family Scaffolds
PF07453	NUMOD1	1.11
PF00499	Oxidored_q3	0.93
PF00961	LAGLIDADG_1	0.74
PF01541	GIY-YIG	0.56
PF00510	COX3	0.37
PF07460	NUMOD3	0.19
PF01070	FMN_dh	0.19
PF00420	Oxidored_q2	0.19
PF00361	Proton_antipo_M	0.19
PF16884	ADH_N_2	0.19
PF00115	COX1	0.19
PF00137	ATP-synt_C	0.19
PF03161	LAGLIDADG_2	0.19

COG ID	Name	Functional Category	% Frequency in 539 Family Scaffolds
COG0839	NADH:ubiquinone oxidoreductase subunit 6 (chain J)	Energy production and conversion [C]	0.93
COG1845	Heme/copper-type cytochrome/quinol oxidase, subunit 3	Energy production and conversion [C]	0.37
COG0069	Glutamate synthase domain 2	Amino acid transport and metabolism [E]	0.19
COG0636	FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K	Energy production and conversion [C]	0.19
COG1304	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase	Energy production and conversion [C]	0.19

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	82.75 %
Unclassified	root	N/A	17.25 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	82.75 %
Unclassified	root	N/A	17.25 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	82.56 %
Unclassified	root	N/A	17.25 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.19 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	58.81 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	22.08 %
Unclassified	root	N/A	17.25 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.19 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	58.81 %
Unclassified	root	N/A	17.25 %
Fungi	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	17.07 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.19 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	58.81 %
Unclassified	root	N/A	17.25 %
Fungi incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis	13.73 %
Dikarya	subkingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	2.23 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.19 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	58.81 %
Unclassified	root	N/A	17.25 %
Mucoromycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota	13.73 %
Ascomycota	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota	2.04 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	0.19 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	58.63 %
Unclassified	root	N/A	17.25 %
Glomeromycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina	13.73 %
saccharomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta	2.04 %
Massilia group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group	0.19 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	58.63 %
Unclassified	root	N/A	17.25 %
Glomeromycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes	13.73 %
Pezizomycotina	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	2.04 %
Massilia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia	0.19 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	58.63 %
Unclassified	root	N/A	17.25 %
Diversisporales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales	13.73 %
leotiomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta	1.67 %
unclassified Massilia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia	0.19 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	58.63 %
Unclassified	root	N/A	17.25 %
Diversisporaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae	13.73 %
sordariomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta	1.30 %
dothideomyceta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta	0.37 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	58.63 %
Unclassified	root	N/A	17.25 %
Diversispora	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora	13.73 %
Dothideomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes	0.37 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sordariomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes	0.74 %
Leotiomycetes	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes	0.56 %

Name	Rank	Taxonomy	Distribution
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Sordariomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae	0.37 %
Pleosporomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae	0.37 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.19 %
Hypocreomycetidae	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Helotiales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales	0.56 %

Name	Rank	Taxonomy	Distribution
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Diaporthales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales	0.37 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.19 %
Pleosporales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales	0.19 %
Hypocreales	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Gnomoniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae	0.37 %
Pleosporineae	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae	0.19 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.19 %
Cordycipitaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Name	Rank	Taxonomy	Distribution
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Ophiognomonia	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia	0.37 %
Cordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Cordyceps	0.19 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.19 %
Pleosporaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Name	Rank	Taxonomy	Distribution
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.37 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.19 %
Exserohilum	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Exserohilum	0.19 %
Cordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Cordyceps	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.37 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.19 %
Exserohilum turcicum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Exserohilum → Exserohilum turcicum	0.19 %
Cordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Cordyceps	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Rhizophoraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.37 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.19 %
Exserohilum turcicum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Exserohilum → Exserohilum turcicum	0.19 %
Cordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Cordyceps	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Rhizophora	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.37 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.19 %
Exserohilum turcicum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Exserohilum → Exserohilum turcicum	0.19 %
Cordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Cordyceps	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Rhizophora mucronata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.37 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.19 %
Exserohilum turcicum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Exserohilum → Exserohilum turcicum	0.19 %
Cordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Cordyceps	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Rhizophora mucronata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.37 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.19 %
Exserohilum turcicum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Exserohilum → Exserohilum turcicum	0.19 %
Cordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Cordyceps	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Rhizophora mucronata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.37 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.19 %
Exserohilum turcicum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Exserohilum → Exserohilum turcicum	0.19 %
Cordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Cordyceps	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Name	Rank	Taxonomy	Distribution
Rhizophora mucronata	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	58.44 %
Unclassified	root	N/A	17.25 %
Diversispora epigaea	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	13.73 %
Ophiognomonia clavigignenti-juglandacearum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	0.37 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.19 %
Exserohilum turcicum	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Exserohilum → Exserohilum turcicum	0.19 %
Cordyceps	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Cordyceps	0.19 %
Massilia sp. 9I	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	0.19 %
Sclerotiniaceae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	0.56 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2081372006\|FNTS_contig07820	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	525	Open in IMG/M
3300000305\|bgg_mtDRAFT_1023879	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	2336	Open in IMG/M
3300000305\|bgg_mtDRAFT_1024025	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1323	Open in IMG/M
3300000904\|JGI12053J12875_100839	Not Available	887	Open in IMG/M
3300001088\|JGI12665J13242_100022	All Organisms → cellular organisms → Eukaryota	3543	Open in IMG/M
3300001104\|JGI11756J13266_100175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1370	Open in IMG/M
3300001140\|JGI12675J13321_100280	Not Available	1289	Open in IMG/M
3300001158\|JGI12651J13278_10061	Not Available	1626	Open in IMG/M
3300001305\|C688J14111_10061719	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1135	Open in IMG/M
3300001461\|JGI12698J15209_1002279	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1052	Open in IMG/M
3300001593\|JGI12635J15846_10085208	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2302	Open in IMG/M
3300001661\|JGI12053J15887_10040751	All Organisms → cellular organisms → Eukaryota	2609	Open in IMG/M
3300001661\|JGI12053J15887_10124693	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1374	Open in IMG/M
3300001867\|JGI12627J18819_10179144	Not Available	859	Open in IMG/M
3300001867\|JGI12627J18819_10340238	Not Available	606	Open in IMG/M
3300002077\|JGI24744J21845_10111723	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	508	Open in IMG/M
3300002158\|JGI24771J26695_1000823	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1951	Open in IMG/M
3300002568\|C688J35102_120023216	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	850	Open in IMG/M
3300002568\|C688J35102_120959507	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3168	Open in IMG/M
3300002653\|Ga0005486J37273_101185	All Organisms → cellular organisms → Eukaryota	3349	Open in IMG/M
3300002654\|Ga0005464J37254_100796	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1406	Open in IMG/M
3300002669\|Ga0005479J37267_103397	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1337	Open in IMG/M
3300002672\|Ga0005490J37275_104746	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	2269	Open in IMG/M
3300002681\|Ga0005471J37259_112668	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2299	Open in IMG/M
3300002864\|Ga0006764J43180_108503	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	677	Open in IMG/M
3300002865\|Ga0006761J43178_108075	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	643	Open in IMG/M
3300002907\|JGI25613J43889_10085491	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	839	Open in IMG/M
3300003316\|rootH1_10002729	Not Available	14664	Open in IMG/M
3300003316\|rootH1_10006915	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	2139	Open in IMG/M
3300003316\|rootH1_10071009	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Cordycipitaceae → Cordyceps	1925	Open in IMG/M
3300003505\|JGIcombinedJ51221_10075726	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1317	Open in IMG/M
3300003547\|Ga0006714J51104_102539	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1277	Open in IMG/M
3300003551\|Ga0005498J51100_109987	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1930	Open in IMG/M
3300003563\|Ga0007430J51106_107126	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	946	Open in IMG/M
3300003563\|Ga0007430J51106_114919	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	796	Open in IMG/M
3300003568\|Ga0006781J51513_1009109	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	515	Open in IMG/M
3300003568\|Ga0006781J51513_1021677	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	800	Open in IMG/M
3300003571\|Ga0007419J51692_1052973	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	706	Open in IMG/M
3300003574\|Ga0007410J51695_1058916	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	578	Open in IMG/M
3300003715\|Ga0048256_103583	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	660	Open in IMG/M
3300003715\|Ga0048256_103935	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	526	Open in IMG/M
3300003717\|Ga0006766_128181	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	605	Open in IMG/M
3300003735\|Ga0006780_1018112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	637	Open in IMG/M
3300003735\|Ga0006780_1026080	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	969	Open in IMG/M
3300003845\|Ga0058699_1003860	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	2302	Open in IMG/M
3300003848\|Ga0058694_1007137	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	2818	Open in IMG/M
3300003850\|Ga0058695_1000837	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3731	Open in IMG/M
3300003857\|Ga0058693_1000190	All Organisms → cellular organisms → Eukaryota	26120	Open in IMG/M
3300004081\|Ga0063454_101392683	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	593	Open in IMG/M
3300004118\|Ga0058886_1361017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	997	Open in IMG/M
3300004134\|Ga0058906_1021274	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	766	Open in IMG/M
3300004137\|Ga0058883_1020508	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	588	Open in IMG/M
3300004473\|Ga0068919_1012070	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2515	Open in IMG/M
3300004505\|Ga0068941_1147151	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	919	Open in IMG/M
3300004606\|Ga0068962_1026190	All Organisms → cellular organisms → Eukaryota → Opisthokonta	3014	Open in IMG/M
3300004607\|Ga0068948_1310971	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	642	Open in IMG/M
3300004609\|Ga0068958_1067431	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1058	Open in IMG/M
3300004610\|Ga0068927_1344890	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	741	Open in IMG/M
3300004613\|Ga0068937_1395710	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1515	Open in IMG/M
3300004618\|Ga0068963_1436113	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1321	Open in IMG/M
3300004785\|Ga0058858_1436075	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	832	Open in IMG/M
3300004798\|Ga0058859_11771552	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	650	Open in IMG/M
3300004799\|Ga0058863_10119953	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	682	Open in IMG/M
3300004800\|Ga0058861_10123428	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	965	Open in IMG/M
3300004803\|Ga0058862_10022975	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1068	Open in IMG/M
3300004803\|Ga0058862_12865146	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	702	Open in IMG/M
3300005175\|Ga0066673_10168589	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1230	Open in IMG/M
3300005175\|Ga0066673_10257204	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1012	Open in IMG/M
3300005327\|Ga0070658_10134279	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2064	Open in IMG/M
3300005332\|Ga0066388_103224199	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	834	Open in IMG/M
3300005334\|Ga0068869_100933216	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	753	Open in IMG/M
3300005434\|Ga0070709_10623387	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	833	Open in IMG/M
3300005456\|Ga0070678_101863501	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	567	Open in IMG/M
3300005459\|Ga0068867_100911602	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	791	Open in IMG/M
3300005536\|Ga0070697_101913458	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	531	Open in IMG/M
3300005548\|Ga0070665_100736831	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	999	Open in IMG/M
3300005555\|Ga0066692_10754931	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	600	Open in IMG/M
3300005556\|Ga0066707_10268154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1116	Open in IMG/M
3300005557\|Ga0066704_10155576	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes	1535	Open in IMG/M
3300005562\|Ga0058697_10002064	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	6764	Open in IMG/M
3300005562\|Ga0058697_10095692	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1223	Open in IMG/M
3300005562\|Ga0058697_10152264	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1011	Open in IMG/M
3300005562\|Ga0058697_10159563	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	991	Open in IMG/M
3300005562\|Ga0058697_10545202	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	598	Open in IMG/M
3300005577\|Ga0068857_102563228	Not Available	500	Open in IMG/M
3300005661\|Ga0058698_10103511	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	1524	Open in IMG/M
3300005841\|Ga0068863_101866114	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	611	Open in IMG/M
3300006020\|Ga0058704_10399861	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	795	Open in IMG/M
3300006020\|Ga0058704_10931081	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	514	Open in IMG/M
3300006052\|Ga0075029_100371432	Not Available	925	Open in IMG/M
3300006316\|Ga0068473_1081075	Not Available	1519	Open in IMG/M
3300006357\|Ga0075502_1589514	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	573	Open in IMG/M
3300006688\|Ga0031687_1012807	Not Available	836	Open in IMG/M
3300006794\|Ga0066658_10025759	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	2342	Open in IMG/M
3300006806\|Ga0079220_11360342	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	599	Open in IMG/M
3300006846\|Ga0075430_100048875	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	3571	Open in IMG/M
3300006876\|Ga0079217_10935391	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	624	Open in IMG/M
3300006894\|Ga0079215_10115885	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1212	Open in IMG/M
3300006954\|Ga0079219_10032846	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2071	Open in IMG/M
3300006954\|Ga0079219_10638360	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	791	Open in IMG/M
3300006954\|Ga0079219_11011788	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	691	Open in IMG/M
3300006954\|Ga0079219_11308295	Not Available	639	Open in IMG/M
3300007526\|Ga0075022_1717923	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1097	Open in IMG/M
3300009144\|Ga0058702_10109685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1053	Open in IMG/M
3300009249\|Ga0103862_1052341	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	576	Open in IMG/M
3300009261\|Ga0103870_1055617	Not Available	536	Open in IMG/M
3300009411\|Ga0115017_1029761	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1151	Open in IMG/M
3300009411\|Ga0115017_1081012	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1898	Open in IMG/M
3300009411\|Ga0115017_1443626	Not Available	505	Open in IMG/M
3300009553\|Ga0105249_13205123	Not Available	526	Open in IMG/M
3300009582\|Ga0115601_1093064	Not Available	1409	Open in IMG/M
3300009586\|Ga0115591_1161158	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2750	Open in IMG/M
3300009678\|Ga0105252_10038848	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1769	Open in IMG/M
3300009990\|Ga0105132_135879	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	546	Open in IMG/M
3300010048\|Ga0126373_11491714	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	741	Open in IMG/M
3300010060\|Ga0127425_140901	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1248	Open in IMG/M
3300010061\|Ga0127462_190843	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	892	Open in IMG/M
3300010063\|Ga0127431_122247	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	561	Open in IMG/M
3300010064\|Ga0127433_110363	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	706	Open in IMG/M
3300010068\|Ga0127442_102486	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1058	Open in IMG/M
3300010068\|Ga0127442_125484	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1107	Open in IMG/M
3300010071\|Ga0127477_105649	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	681	Open in IMG/M
3300010071\|Ga0127477_116254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	513	Open in IMG/M
3300010071\|Ga0127477_137542	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	794	Open in IMG/M
3300010071\|Ga0127477_151602	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	676	Open in IMG/M
3300010075\|Ga0127434_118713	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	586	Open in IMG/M
3300010075\|Ga0127434_150839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	959	Open in IMG/M
3300010076\|Ga0127430_117619	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1075	Open in IMG/M
3300010079\|Ga0127436_120446	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1301	Open in IMG/M
3300010079\|Ga0127436_130082	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	566	Open in IMG/M
3300010079\|Ga0127436_166925	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	994	Open in IMG/M
3300010079\|Ga0127436_175002	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	784	Open in IMG/M
3300010080\|Ga0127448_131300	Not Available	2311	Open in IMG/M
3300010081\|Ga0127457_1024732	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	540	Open in IMG/M
3300010083\|Ga0127478_1055610	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	874	Open in IMG/M
3300010084\|Ga0127461_1017992	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	924	Open in IMG/M
3300010084\|Ga0127461_1092513	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	648	Open in IMG/M
3300010086\|Ga0127496_1104335	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	798	Open in IMG/M
3300010088\|Ga0127476_1044333	Not Available	643	Open in IMG/M
3300010088\|Ga0127476_1082007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1013	Open in IMG/M
3300010090\|Ga0127471_1050404	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	653	Open in IMG/M
3300010090\|Ga0127471_1066449	Not Available	612	Open in IMG/M
3300010096\|Ga0127473_1068611	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	691	Open in IMG/M
3300010097\|Ga0127501_1108571	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	762	Open in IMG/M
3300010105\|Ga0127470_1124799	Not Available	881	Open in IMG/M
3300010105\|Ga0127470_1143863	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	652	Open in IMG/M
3300010106\|Ga0127472_1040222	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	826	Open in IMG/M
3300010107\|Ga0127494_1069101	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1051	Open in IMG/M
3300010111\|Ga0127491_1074848	Not Available	1034	Open in IMG/M
3300010114\|Ga0127460_1040625	Not Available	613	Open in IMG/M
3300010116\|Ga0127466_1101980	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1976	Open in IMG/M
3300010116\|Ga0127466_1103757	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	723	Open in IMG/M
3300010123\|Ga0127479_1099585	Not Available	849	Open in IMG/M
3300010125\|Ga0127443_1076252	Not Available	569	Open in IMG/M
3300010125\|Ga0127443_1088044	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	865	Open in IMG/M
3300010125\|Ga0127443_1173328	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1026	Open in IMG/M
3300010128\|Ga0127486_1176755	Not Available	1082	Open in IMG/M
3300010132\|Ga0127455_1078032	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	675	Open in IMG/M
3300010136\|Ga0127447_1034379	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	723	Open in IMG/M
3300010136\|Ga0127447_1047308	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	922	Open in IMG/M
3300010136\|Ga0127447_1186344	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	618	Open in IMG/M
3300010144\|Ga0115593_1365699	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1473	Open in IMG/M
3300010144\|Ga0115593_1395384	Not Available	941	Open in IMG/M
3300010146\|Ga0126320_1146232	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1049	Open in IMG/M
3300010147\|Ga0126319_1260243	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	712	Open in IMG/M
3300010161\|Ga0136170_1000211	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1034	Open in IMG/M
3300010192\|Ga0127506_1079225	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	689	Open in IMG/M
3300010192\|Ga0127506_1145371	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	501	Open in IMG/M
3300010200\|Ga0127507_1135642	Not Available	842	Open in IMG/M
3300010366\|Ga0126379_13264917	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	543	Open in IMG/M
3300010395\|Ga0058701_10464359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	724	Open in IMG/M
3300010855\|Ga0126355_1036861	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	596	Open in IMG/M
3300010857\|Ga0126354_1266437	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	999	Open in IMG/M
3300010867\|Ga0126347_1166623	Not Available	681	Open in IMG/M
3300010870\|Ga0102750_10276986	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	643	Open in IMG/M
3300010870\|Ga0102750_10452918	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	697	Open in IMG/M
3300010874\|Ga0136264_10199176	Not Available	678	Open in IMG/M
3300010874\|Ga0136264_10233826	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	635	Open in IMG/M
3300010878\|Ga0136899_10044493	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1166	Open in IMG/M
3300011072\|Ga0138563_1148941	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	748	Open in IMG/M
3300011074\|Ga0138559_1085379	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1340	Open in IMG/M
3300011120\|Ga0150983_16366698	Not Available	626	Open in IMG/M
3300012205\|Ga0137362_10100638	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2433	Open in IMG/M
3300012206\|Ga0137380_10784437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	823	Open in IMG/M
3300012212\|Ga0150985_101240334	Not Available	625	Open in IMG/M
3300012212\|Ga0150985_102657957	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	985	Open in IMG/M
3300012212\|Ga0150985_107223057	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	1158	Open in IMG/M
3300012212\|Ga0150985_109579947	Not Available	1226	Open in IMG/M
3300012212\|Ga0150985_110375439	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1139	Open in IMG/M
3300012212\|Ga0150985_111414480	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1057	Open in IMG/M
3300012212\|Ga0150985_114206365	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1118	Open in IMG/M
3300012364\|Ga0134027_1016043	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	564	Open in IMG/M
3300012373\|Ga0134042_1006087	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1018	Open in IMG/M
3300012373\|Ga0134042_1016178	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	866	Open in IMG/M
3300012373\|Ga0134042_1118264	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1181	Open in IMG/M
3300012374\|Ga0134039_1178278	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	785	Open in IMG/M
3300012376\|Ga0134032_1106729	Not Available	1255	Open in IMG/M
3300012380\|Ga0134047_1037356	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	988	Open in IMG/M
3300012383\|Ga0134033_1256526	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	748	Open in IMG/M
3300012385\|Ga0134023_1298377	Not Available	518	Open in IMG/M
3300012388\|Ga0134031_1208510	Not Available	860	Open in IMG/M
3300012389\|Ga0134040_1251875	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	2027	Open in IMG/M
3300012392\|Ga0134043_1181429	Not Available	779	Open in IMG/M
3300012393\|Ga0134052_1028466	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	967	Open in IMG/M
3300012395\|Ga0134044_1304912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	700	Open in IMG/M
3300012397\|Ga0134056_1322542	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	834	Open in IMG/M
3300012401\|Ga0134055_1194332	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	821	Open in IMG/M
3300012403\|Ga0134049_1149698	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	790	Open in IMG/M
3300012469\|Ga0150984_101040246	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1222	Open in IMG/M
3300012469\|Ga0150984_107409764	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	961	Open in IMG/M
3300012469\|Ga0150984_119267710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	998	Open in IMG/M
3300012469\|Ga0150984_122125315	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	980	Open in IMG/M
3300012671\|Ga0137318_1000041	All Organisms → cellular organisms → Eukaryota	5095	Open in IMG/M
3300012722\|Ga0157630_1161144	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	563	Open in IMG/M
3300012723\|Ga0157604_1116261	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	916	Open in IMG/M
3300012757\|Ga0157628_1114432	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	595	Open in IMG/M
3300012888\|Ga0160429_1150718	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	821	Open in IMG/M
3300012902\|Ga0157291_10282904	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	567	Open in IMG/M
3300012929\|Ga0137404_12339757	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	500	Open in IMG/M
3300013296\|Ga0157374_12672569	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	527	Open in IMG/M
3300013307\|Ga0157372_11273855	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	849	Open in IMG/M
3300013867\|Ga0181467_102746	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4807	Open in IMG/M
3300013871\|Ga0181466_1000359	Not Available	17120	Open in IMG/M
3300014326\|Ga0157380_12178927	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	618	Open in IMG/M
3300014969\|Ga0157376_11368408	Not Available	739	Open in IMG/M
3300015341\|Ga0182187_1009206	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1383	Open in IMG/M
3300017011\|Ga0186134_106940	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1316	Open in IMG/M
3300017412\|Ga0182199_1040153	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	919	Open in IMG/M
3300017421\|Ga0182213_1090663	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	845	Open in IMG/M
3300017435\|Ga0182194_1029438	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	925	Open in IMG/M
3300017446\|Ga0182217_1058561	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	894	Open in IMG/M
3300017684\|Ga0182225_1054394	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	680	Open in IMG/M
3300017689\|Ga0182231_1035130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	934	Open in IMG/M
3300017792\|Ga0163161_10049886	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	3027	Open in IMG/M
3300017946\|Ga0187879_10743202	Not Available	547	Open in IMG/M
3300018012\|Ga0187810_10023358	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	2237	Open in IMG/M
3300018414\|Ga0194135_10259225	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1179	Open in IMG/M
3300018433\|Ga0066667_10006530	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5214	Open in IMG/M
3300018465\|Ga0190269_10059770	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1774	Open in IMG/M
3300018466\|Ga0190268_10174810	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1135	Open in IMG/M
3300018466\|Ga0190268_11216376	Not Available	626	Open in IMG/M
3300018468\|Ga0066662_10439443	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1163	Open in IMG/M
3300018481\|Ga0190271_11169164	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	892	Open in IMG/M
3300018587\|Ga0193241_1008346	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	519	Open in IMG/M
3300018659\|Ga0193067_1018028	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1017	Open in IMG/M
3300018725\|Ga0193517_1038076	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	899	Open in IMG/M
3300018758\|Ga0193058_1074173	Not Available	542	Open in IMG/M
3300018920\|Ga0190273_10381351	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum	983	Open in IMG/M
3300018920\|Ga0190273_11149687	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	656	Open in IMG/M
3300018949\|Ga0193010_10018453	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	959	Open in IMG/M
3300019022\|Ga0192951_10228420	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	690	Open in IMG/M
3300019031\|Ga0193516_10080738	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1102	Open in IMG/M
3300019031\|Ga0193516_10238468	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	594	Open in IMG/M
3300019112\|Ga0193106_1037157	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	584	Open in IMG/M
3300019161\|Ga0184602_115899	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1275	Open in IMG/M
3300019194\|Ga0184586_124109	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	944	Open in IMG/M
3300019228\|Ga0180119_1010475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	761	Open in IMG/M
3300019238\|Ga0180112_1172698	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	716	Open in IMG/M
3300019244\|Ga0180111_1177228	Not Available	2081	Open in IMG/M
3300019249\|Ga0184648_1010120	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	2414	Open in IMG/M
3300019254\|Ga0184641_1389982	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	519	Open in IMG/M
3300019255\|Ga0184643_1023418	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1200	Open in IMG/M
3300019255\|Ga0184643_1148176	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1062	Open in IMG/M
3300019263\|Ga0184647_1325597	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	716	Open in IMG/M
3300019263\|Ga0184647_1491710	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1173	Open in IMG/M
3300019265\|Ga0187792_1058514	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	509	Open in IMG/M
3300019361\|Ga0173482_10041633	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1449	Open in IMG/M
3300019887\|Ga0193729_1000099	Not Available	38105	Open in IMG/M
3300019888\|Ga0193751_1125449	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	951	Open in IMG/M
3300019999\|Ga0193718_1000386	All Organisms → cellular organisms → Eukaryota → Opisthokonta	10194	Open in IMG/M
3300020069\|Ga0197907_10351788	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1020	Open in IMG/M
3300020069\|Ga0197907_10511380	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	835	Open in IMG/M
3300020069\|Ga0197907_10585286	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1025	Open in IMG/M
3300020069\|Ga0197907_10586550	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1102	Open in IMG/M
3300020069\|Ga0197907_10908730	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1109	Open in IMG/M
3300020075\|Ga0206349_1256115	Not Available	687	Open in IMG/M
3300020075\|Ga0206349_1689461	Not Available	503	Open in IMG/M
3300020075\|Ga0206349_1842426	Not Available	897	Open in IMG/M
3300020076\|Ga0206355_1352270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	934	Open in IMG/M
3300020076\|Ga0206355_1658960	Not Available	985	Open in IMG/M
3300020076\|Ga0206355_1698124	Not Available	897	Open in IMG/M
3300020078\|Ga0206352_10410360	Not Available	1140	Open in IMG/M
3300020078\|Ga0206352_10864269	Not Available	994	Open in IMG/M
3300020080\|Ga0206350_11111963	Not Available	941	Open in IMG/M
3300020082\|Ga0206353_11896303	Not Available	1002	Open in IMG/M
3300020082\|Ga0206353_12065791	Not Available	1165	Open in IMG/M
3300020580\|Ga0210403_10016993	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae	5818	Open in IMG/M
3300020582\|Ga0210395_10700444	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	757	Open in IMG/M
3300020610\|Ga0154015_1565374	Not Available	675	Open in IMG/M
3300020610\|Ga0154015_1644767	Not Available	968	Open in IMG/M
3300021060\|Ga0182232_1063571	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	605	Open in IMG/M
3300021170\|Ga0210400_10068771	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	2770	Open in IMG/M
3300021180\|Ga0210396_10030327	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	5000	Open in IMG/M
3300021273\|Ga0210340_1076121	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	585	Open in IMG/M
3300021401\|Ga0210393_11388162	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	561	Open in IMG/M
3300021849\|Ga0210304_1060960	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	668	Open in IMG/M
3300021966\|Ga0226662_10139009	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	880	Open in IMG/M
3300021967\|Ga0213848_1013613	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	540	Open in IMG/M
3300021982\|Ga0226661_10272485	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	961	Open in IMG/M
3300022465\|Ga0213505_104253	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1181	Open in IMG/M
3300022467\|Ga0224712_10293710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	759	Open in IMG/M
3300022467\|Ga0224712_10306637	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	743	Open in IMG/M
3300022498\|Ga0242644_1027189	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	600	Open in IMG/M
3300022499\|Ga0242641_1025976	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	619	Open in IMG/M
3300022504\|Ga0242642_1009490	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1177	Open in IMG/M
3300022532\|Ga0242655_10298720	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	524	Open in IMG/M
3300022709\|Ga0222756_1010706	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1047	Open in IMG/M
3300022711\|Ga0242674_1009019	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1012	Open in IMG/M
3300022717\|Ga0242661_1001095	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi	2652	Open in IMG/M
3300022718\|Ga0242675_1081815	Not Available	594	Open in IMG/M
3300022749\|Ga0255028_107519	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	739	Open in IMG/M
3300022891\|Ga0247770_1000457	Not Available	39429	Open in IMG/M
3300022894\|Ga0247778_1007380	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2511	Open in IMG/M
3300022903\|Ga0247774_1155828	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	541	Open in IMG/M
3300022904\|Ga0247769_1000008	Not Available	40335	Open in IMG/M
3300022910\|Ga0247768_1000072	Not Available	39016	Open in IMG/M
3300022911\|Ga0247783_1076730	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Pleosporomycetidae → Pleosporales → Pleosporineae → Pleosporaceae → Exserohilum → Exserohilum turcicum	895	Open in IMG/M
3300023076\|Ga0247731_1057518	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	965	Open in IMG/M
3300023104\|Ga0247805_1019129	Not Available	2691	Open in IMG/M
3300023280\|Ga0255813_11644365	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1653	Open in IMG/M
3300023541\|Ga0247544_100313	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	957	Open in IMG/M
3300023666\|Ga0247531_114861	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	575	Open in IMG/M
3300023697\|Ga0228706_1013935	Not Available	970	Open in IMG/M
3300024288\|Ga0179589_10089222	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1241	Open in IMG/M
3300024342\|Ga0255061_10324507	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	800	Open in IMG/M
3300024342\|Ga0255061_10412839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	705	Open in IMG/M
3300024483\|Ga0255224_1094969	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	624	Open in IMG/M
3300024487\|Ga0255222_1043434	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	674	Open in IMG/M
3300025921\|Ga0207652_10462391	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1143	Open in IMG/M
3300025937\|Ga0207669_10661497	Not Available	855	Open in IMG/M
3300026078\|Ga0207702_10394144	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1334	Open in IMG/M
3300026078\|Ga0207702_10606669	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1074	Open in IMG/M
3300026078\|Ga0207702_10963526	Not Available	846	Open in IMG/M
3300026116\|Ga0207674_11728176	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	594	Open in IMG/M
3300026319\|Ga0209647_1091975	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1468	Open in IMG/M
3300026493\|Ga0256786_1011005	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2957	Open in IMG/M
3300027037\|Ga0209005_1033317	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	627	Open in IMG/M
3300027075\|Ga0214467_1005621	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1239	Open in IMG/M
3300027075\|Ga0214467_1008853	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1016	Open in IMG/M
3300027504\|Ga0209114_1084146	Not Available	582	Open in IMG/M
3300027513\|Ga0208685_1051960	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	886	Open in IMG/M
3300027619\|Ga0209330_1073505	Not Available	780	Open in IMG/M
3300027663\|Ga0208990_1199696	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	508	Open in IMG/M
3300027718\|Ga0209795_10100724	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	828	Open in IMG/M
3300027737\|Ga0209038_10054081	Not Available	1203	Open in IMG/M
3300027765\|Ga0209073_10023928	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1834	Open in IMG/M
3300027765\|Ga0209073_10188743	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	779	Open in IMG/M
3300027809\|Ga0209574_10105929	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	806	Open in IMG/M
3300028140\|Ga0268334_1000803	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1389	Open in IMG/M
3300028153\|Ga0268320_1024354	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	539	Open in IMG/M
3300028170\|Ga0256906_1141159	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	535	Open in IMG/M
3300028181\|Ga0256909_1050769	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	943	Open in IMG/M
3300028237\|Ga0302338_1055549	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	778	Open in IMG/M
3300028246\|Ga0268351_1022326	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	638	Open in IMG/M
3300028379\|Ga0268266_10658303	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1008	Open in IMG/M
3300028554\|Ga0302047_10073057	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	643	Open in IMG/M
3300028554\|Ga0302047_10208980	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	697	Open in IMG/M
3300028588\|Ga0265780_10284142	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	1499	Open in IMG/M
3300028709\|Ga0307279_10000002	Not Available	39680	Open in IMG/M
3300030514\|Ga0268253_10036950	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1235	Open in IMG/M
3300030515\|Ga0268254_10001065	Not Available	11274	Open in IMG/M
3300030531\|Ga0210274_1091383	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	800	Open in IMG/M
3300030537\|Ga0247642_1004448	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	832	Open in IMG/M
3300030546\|Ga0247646_1055778	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	840	Open in IMG/M
3300030546\|Ga0247646_1083124	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	753	Open in IMG/M
3300030551\|Ga0247638_1035751	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	890	Open in IMG/M
3300030555\|Ga0247618_1115787	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	585	Open in IMG/M
3300030563\|Ga0247653_1001033	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1159	Open in IMG/M
3300030571\|Ga0247652_1043115	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	766	Open in IMG/M
3300030574\|Ga0247648_1156641	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	562	Open in IMG/M
3300030576\|Ga0247644_1009839	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1123	Open in IMG/M
3300030596\|Ga0210278_1025333	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	958	Open in IMG/M
3300030596\|Ga0210278_1084628	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	684	Open in IMG/M
3300030608\|Ga0247651_10135308	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	685	Open in IMG/M
3300030682\|Ga0247622_1048079	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	823	Open in IMG/M
3300030692\|Ga0268250_10675713	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	559	Open in IMG/M
3300030738\|Ga0265462_10083974	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1325	Open in IMG/M
3300030758\|Ga0138305_1533305	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1084	Open in IMG/M
3300030768\|Ga0315877_111270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	896	Open in IMG/M
3300030779\|Ga0075378_10064592	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	920	Open in IMG/M
3300030784\|Ga0102758_10037445	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1332	Open in IMG/M
3300030784\|Ga0102758_10059152	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1068	Open in IMG/M
3300030784\|Ga0102758_10064159	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1008	Open in IMG/M
3300030789\|Ga0102766_10108685	Not Available	524	Open in IMG/M
3300030789\|Ga0102766_11015843	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	582	Open in IMG/M
3300030792\|Ga0265790_103949	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1026	Open in IMG/M
3300030792\|Ga0265790_104764	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	956	Open in IMG/M
3300030793\|Ga0265796_103623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1065	Open in IMG/M
3300030793\|Ga0265796_104706	Not Available	964	Open in IMG/M
3300030794\|Ga0265788_112705	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	539	Open in IMG/M
3300030798\|Ga0265781_105225	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	805	Open in IMG/M
3300030807\|Ga0265791_100982	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1744	Open in IMG/M
3300030807\|Ga0265791_105725	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	932	Open in IMG/M
3300030809\|Ga0265793_105132	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	823	Open in IMG/M
3300030820\|Ga0315872_110999	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	784	Open in IMG/M
3300030822\|Ga0315851_103267	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1098	Open in IMG/M
3300030827\|Ga0315871_105525	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	922	Open in IMG/M
3300030851\|Ga0075380_10089278	Not Available	618	Open in IMG/M
3300030858\|Ga0102759_1039603	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	928	Open in IMG/M
3300030860\|Ga0074000_10131239	Not Available	736	Open in IMG/M
3300030861\|Ga0102755_1386367	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	552	Open in IMG/M
3300030885\|Ga0265743_100079	All Organisms → cellular organisms → Eukaryota	3097	Open in IMG/M
3300030889\|Ga0265761_100047	All Organisms → cellular organisms → Eukaryota	3591	Open in IMG/M
3300030891\|Ga0315865_103977	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1117	Open in IMG/M
3300030896\|Ga0315859_103956	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1051	Open in IMG/M
3300030902\|Ga0308202_1004254	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1700	Open in IMG/M
3300030903\|Ga0308206_1139330	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	576	Open in IMG/M
3300030926\|Ga0315879_105368	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	980	Open in IMG/M
3300030928\|Ga0315867_102805	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	951	Open in IMG/M
3300030937\|Ga0138302_1009262	Not Available	551	Open in IMG/M
3300030938\|Ga0138299_10275510	Not Available	582	Open in IMG/M
3300030977\|Ga0265721_1009312	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	593	Open in IMG/M
3300030978\|Ga0265757_100216	All Organisms → cellular organisms → Eukaryota	1946	Open in IMG/M
3300030979\|Ga0068589_10125391	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	614	Open in IMG/M
3300030984\|Ga0315857_108036	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1086	Open in IMG/M
3300030988\|Ga0308183_1030445	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	986	Open in IMG/M
3300030989\|Ga0308196_1009269	Not Available	993	Open in IMG/M
3300030990\|Ga0308178_1167992	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	515	Open in IMG/M
3300030993\|Ga0308190_1017326	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1141	Open in IMG/M
3300030993\|Ga0308190_1022335	Not Available	1051	Open in IMG/M
3300030993\|Ga0308190_1202518	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	500	Open in IMG/M
3300031014\|Ga0102756_1042818	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	740	Open in IMG/M
3300031021\|Ga0102765_10125914	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1194	Open in IMG/M
3300031021\|Ga0102765_10144385	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	529	Open in IMG/M
3300031022\|Ga0138301_1034520	Not Available	585	Open in IMG/M
3300031026\|Ga0315862_108428	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	674	Open in IMG/M
3300031055\|Ga0102751_1378927	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	715	Open in IMG/M
3300031057\|Ga0170834_107023241	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	825	Open in IMG/M
3300031058\|Ga0308189_10067885	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1045	Open in IMG/M
3300031074\|Ga0315826_104884	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1033	Open in IMG/M
3300031075\|Ga0315822_112259	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	504	Open in IMG/M
3300031082\|Ga0308192_1010252	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1097	Open in IMG/M
3300031086\|Ga0074002_10143515	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	517	Open in IMG/M
3300031089\|Ga0102748_10046950	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1361	Open in IMG/M
3300031091\|Ga0308201_10080591	Not Available	897	Open in IMG/M
3300031099\|Ga0308181_1071908	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	700	Open in IMG/M
3300031102\|Ga0315816_1042017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	595	Open in IMG/M
3300031105\|Ga0315823_108540	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	935	Open in IMG/M
3300031106\|Ga0315839_104472	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1302	Open in IMG/M
3300031108\|Ga0315834_104334	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1006	Open in IMG/M
3300031109\|Ga0315824_103582	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Leotiomycetes → Helotiales → Sclerotiniaceae	981	Open in IMG/M
3300031114\|Ga0308187_10141188	Not Available	794	Open in IMG/M
3300031114\|Ga0308187_10187703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	715	Open in IMG/M
3300031114\|Ga0308187_10249682	Not Available	644	Open in IMG/M
3300031116\|Ga0318490_1435048	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	812	Open in IMG/M
3300031123\|Ga0308195_1011578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	976	Open in IMG/M
3300031123\|Ga0308195_1014508	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	906	Open in IMG/M
3300031263\|Ga0315815_102713	Not Available	1053	Open in IMG/M
3300031422\|Ga0308186_1040924	Not Available	504	Open in IMG/M
3300031446\|Ga0170820_15592800	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	505	Open in IMG/M
3300031458\|Ga0315836_107155	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	911	Open in IMG/M
3300031461\|Ga0315812_104973	Not Available	1054	Open in IMG/M
3300031461\|Ga0315812_119575	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	584	Open in IMG/M
3300031474\|Ga0170818_100235899	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	874	Open in IMG/M
3300031505\|Ga0308150_1003163	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina	1313	Open in IMG/M
3300031731\|Ga0307405_11436770	Not Available	604	Open in IMG/M
3300031869\|Ga0316030_112493	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	501	Open in IMG/M
3300031872\|Ga0316033_108385	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	619	Open in IMG/M
3300031938\|Ga0308175_100777718	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1045	Open in IMG/M
3300032002\|Ga0307416_100075564	All Organisms → cellular organisms → Eukaryota → Opisthokonta	2820	Open in IMG/M
3300032074\|Ga0308173_10206142	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1636	Open in IMG/M
3300032466\|Ga0214503_1053997	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1208	Open in IMG/M
3300032466\|Ga0214503_1101495	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	895	Open in IMG/M
3300032490\|Ga0214495_1045554	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1018	Open in IMG/M
3300032490\|Ga0214495_1052445	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	951	Open in IMG/M
3300032502\|Ga0214490_1036017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1094	Open in IMG/M
3300032514\|Ga0214502_1082389	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1208	Open in IMG/M
3300032514\|Ga0214502_1083656	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1199	Open in IMG/M
3300032514\|Ga0214502_1092236	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1145	Open in IMG/M
3300032514\|Ga0214502_1151815	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	889	Open in IMG/M
3300032514\|Ga0214502_1239788	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	692	Open in IMG/M
3300032515\|Ga0348332_12934710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1200	Open in IMG/M
3300032550\|Ga0321340_1014943	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1067	Open in IMG/M
3300032590\|Ga0214489_1005150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1631	Open in IMG/M
3300032592\|Ga0214504_1034834	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	981	Open in IMG/M
3300032697\|Ga0214499_1077519	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1006	Open in IMG/M
3300032697\|Ga0214499_1078901	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	997	Open in IMG/M
3300032757\|Ga0314753_1023695	Not Available	1102	Open in IMG/M
3300032757\|Ga0314753_1039453	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	858	Open in IMG/M
3300032757\|Ga0314753_1077283	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	591	Open in IMG/M
3300032758\|Ga0314746_1055953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	915	Open in IMG/M
3300032758\|Ga0314746_1057411	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	904	Open in IMG/M
3300032758\|Ga0314746_1144555	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	531	Open in IMG/M
3300032760\|Ga0314754_1034865	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	797	Open in IMG/M
3300032761\|Ga0314733_1085250	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	599	Open in IMG/M
3300032781\|Ga0314742_1061307	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	655	Open in IMG/M
3300032781\|Ga0314742_1089546	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. 9I	517	Open in IMG/M
3300032790\|Ga0314731_1021380	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1060	Open in IMG/M
3300032792\|Ga0314744_1036099	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	966	Open in IMG/M
3300032812\|Ga0314745_1079989	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	693	Open in IMG/M
3300032821\|Ga0314719_1033680	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	636	Open in IMG/M
3300032822\|Ga0314740_1036223	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	742	Open in IMG/M
3300032823\|Ga0314723_1038393	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	914	Open in IMG/M
3300032824\|Ga0314735_1041618	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	868	Open in IMG/M
3300032826\|Ga0314732_119663	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	667	Open in IMG/M
3300032845\|Ga0314727_1010881	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	1209	Open in IMG/M
3300032845\|Ga0314727_1022401	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	881	Open in IMG/M
3300032889\|Ga0314751_1047281	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	873	Open in IMG/M
3300032889\|Ga0314751_1061414	Not Available	765	Open in IMG/M
3300032913\|Ga0314739_1017779	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1277	Open in IMG/M
3300032914\|Ga0314750_1043379	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1021	Open in IMG/M
3300032914\|Ga0314750_1046550	Not Available	989	Open in IMG/M
3300032914\|Ga0314750_1103731	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	662	Open in IMG/M
3300032915\|Ga0314749_1032413	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1101	Open in IMG/M
3300032915\|Ga0314749_1032671	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1098	Open in IMG/M
3300032915\|Ga0314749_1143720	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	506	Open in IMG/M
3300032916\|Ga0314734_1028575	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1094	Open in IMG/M
3300032916\|Ga0314734_1068460	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	714	Open in IMG/M
3300032916\|Ga0314734_1072581	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	691	Open in IMG/M
3300032934\|Ga0314741_1026587	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1275	Open in IMG/M
3300032934\|Ga0314741_1035770	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1124	Open in IMG/M
3300032934\|Ga0314741_1046219	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1003	Open in IMG/M
3300032934\|Ga0314741_1088426	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	718	Open in IMG/M
3300032966\|Ga0314722_1030909	Not Available	856	Open in IMG/M
3300033523\|Ga0314768_1172731	Not Available	759	Open in IMG/M
3300033523\|Ga0314768_1312923	Not Available	547	Open in IMG/M
3300033525\|Ga0314758_1084768	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	886	Open in IMG/M
3300033525\|Ga0314758_1120609	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	725	Open in IMG/M
3300033530\|Ga0314760_1083412	Not Available	792	Open in IMG/M
3300033530\|Ga0314760_1105961	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	694	Open in IMG/M
3300033531\|Ga0314756_1020104	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1172	Open in IMG/M
3300033532\|Ga0314767_1050670	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1008	Open in IMG/M
3300033532\|Ga0314767_1119145	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	661	Open in IMG/M
3300033533\|Ga0314770_1015981	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1914	Open in IMG/M
3300033533\|Ga0314770_1088676	All Organisms → cellular organisms → Eukaryota	958	Open in IMG/M
3300033533\|Ga0314770_1142789	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea	751	Open in IMG/M
3300033533\|Ga0314770_1281856	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	520	Open in IMG/M
3300033534\|Ga0314757_1026522	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1327	Open in IMG/M
3300033534\|Ga0314757_1027450	Not Available	1307	Open in IMG/M
3300033534\|Ga0314757_1179570	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	507	Open in IMG/M
3300033535\|Ga0314759_1149424	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	743	Open in IMG/M
3300033536\|Ga0314763_1031583	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	818	Open in IMG/M
3300033536\|Ga0314763_1033807	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	793	Open in IMG/M
3300033537\|Ga0314766_1053758	Not Available	1369	Open in IMG/M
3300033537\|Ga0314766_1130129	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	908	Open in IMG/M
3300033537\|Ga0314766_1168316	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya	794	Open in IMG/M
3300033538\|Ga0314755_1041182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	1141	Open in IMG/M
3300033538\|Ga0314755_1059208	Not Available	962	Open in IMG/M
3300033542\|Ga0314769_1177215	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata	715	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	66.98%
Host-Associated	Host-Associated	31.91%
Engineered	Engineered	1.11%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	57.70%
Plants	Host-Associated → Plants	29.68%
Aquatic	Environmental → Aquatic	9.28%
Human	Host-Associated → Human	1.67%
Mammals	Host-Associated → Mammals	0.56%
Built Environment	Engineered → Built Environment	0.56%
Bioreactor	Engineered → Bioreactor	0.37%
Solid Waste	Engineered → Solid Waste	0.19%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	49.54%
Phyllosphere	Host-Associated → Plants → Phyllosphere	16.88%
Plant Litter	Environmental → Terrestrial → Plant Litter	7.42%
Freshwater	Environmental → Aquatic → Freshwater	5.94%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.27%
Rhizoplane	Host-Associated → Plants → Rhizoplane	4.08%
Phylloplane	Host-Associated → Plants → Phylloplane	3.15%
Marine	Environmental → Aquatic → Marine	2.60%
Digestive System	Host-Associated → Human → Digestive System	1.67%
Sediment	Environmental → Aquatic → Sediment	0.74%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.56%
Digestive System	Host-Associated → Mammals → Digestive System	0.56%
Rhizome	Host-Associated → Plants → Rhizome	0.56%
Peat Moss	Host-Associated → Plants → Peat Moss	0.56%
Aerobic	Engineered → Bioreactor → Aerobic	0.37%
Unclassified	Engineered → Built Environment → Unclassified	0.37%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.19%
Unclassified	Host-Associated → Plants → Unclassified	0.19%
Landfill	Engineered → Solid Waste → Landfill	0.19%
Solar Panel	Engineered → Built Environment → Solar Panel	0.19%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.49%
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	16.51%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	7.42%
Loam	Environmental → Terrestrial → Soil → Loam	6.68%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.15%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	3.15%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.04%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.86%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.67%
Large Intestine	Host-Associated → Human → Digestive System → Large Intestine	1.67%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.48%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.74%
Lake	Environmental → Aquatic → Freshwater → Lake	0.56%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.56%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.56%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.56%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified	0.56%
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified	0.56%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.37%
River	Environmental → Aquatic → Freshwater → River	0.37%
Oceanic	Environmental → Aquatic → Marine → Oceanic	0.37%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.37%
Foregut	Host-Associated → Mammals → Digestive System → Foregut	0.37%
Phylloplane/Leaf Surface	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface	0.37%
Unclassified	Engineered → Bioreactor → Aerobic → Unclassified	0.37%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified	0.37%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.19%
Creek	Environmental → Aquatic → Freshwater → Creek	0.19%
Coastal	Environmental → Aquatic → Marine → Coastal	0.19%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.19%
Sand	Environmental → Terrestrial → Soil → Sand	0.19%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.19%
Large Intestine	Host-Associated → Mammals → Digestive System → Large Intestine	0.19%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.19%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	0.19%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	0.19%
Unclassified	Engineered → Built Environment → Solar Panel → Unclassified	0.19%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.09%
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	16.51%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	11.50%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	7.42%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	5.01%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.15%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	3.15%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.78%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.04%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.86%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.67%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.67%
Fecal	Host-Associated → Human → Digestive System → Large Intestine → Fecal	1.67%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	1.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.48%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	1.11%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.74%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.56%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.56%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.56%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.56%
Unclassified	Host-Associated → Plants → Rhizome → Unclassified → Unclassified	0.56%
Unclassified	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified	0.56%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.37%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.37%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	0.37%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.37%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.37%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.37%
Rumen	Host-Associated → Mammals → Digestive System → Foregut → Rumen	0.37%
Unclassified	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified	0.37%
Unclassified	Engineered → Bioreactor → Aerobic → Unclassified → Unclassified	0.37%
Unclassified	Engineered → Built Environment → Unclassified → Unclassified → Unclassified	0.37%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	0.19%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.19%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.19%
Unclassified	Environmental → Aquatic → Marine → Oceanic → Unclassified	0.19%
Aphotic Zone	Environmental → Aquatic → Marine → Oceanic → Aphotic Zone	0.19%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.19%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.19%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.19%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.19%
Fecal	Host-Associated → Mammals → Digestive System → Large Intestine → Fecal	0.19%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.19%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	0.19%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	0.19%
Unclassified	Engineered → Built Environment → Solar Panel → Unclassified → Unclassified	0.19%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	15.21%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	11.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	10.95%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.61%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	7.24%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	4.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	3.71%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	3.15%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	2.04%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	2.04%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.86%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.67%
Marine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine	1.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.67%
Host-Associated	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated	1.67%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	1.11%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.93%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.74%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.74%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.74%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.74%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.56%
Soil	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil	0.56%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.56%
Enriched Soil Aggregate	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate	0.56%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.56%
Serpentinite Rock And Fluid	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid	0.56%
Sugarcane Root And Bulk Soil	Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil	0.56%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.56%
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	0.56%
Host-Associated	Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated	0.56%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.56%
River Water	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water	0.37%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	0.37%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.37%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.37%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.37%
Rumen	Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen	0.37%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.37%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.37%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.37%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.37%
Agave	Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave	0.37%
Food Waste	Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste	0.37%
Clean Room	Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room	0.37%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	0.19%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.19%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.19%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.19%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.19%
Deep Ocean	Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean	0.19%
Marine	Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine	0.19%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.19%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.19%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.19%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.19%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.19%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.19%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.19%
Phyllosphere	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Phyllosphere	0.19%
Feces	Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Feces	0.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.19%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.19%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.19%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.19%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.19%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.19%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.19%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.19%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.19%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	0.19%
Food Waste	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste	0.19%
Solar Cell Surface	Engineered → Built Environment → Solar Panel → Unclassified → Unclassified → Solar Cell Surface	0.19%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2081372006	Soil microbial communities from sample at FACE Site NTS_071 Nevada Test Site	Environmental	Open in IMG/M
3300000305	Blue grama grass rhizosphere microbial communities from Sevilleta, New Mexico, USA - Combined Assembly	Host-Associated	Open in IMG/M
3300000904	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3	Environmental	Open in IMG/M
3300001088	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2	Environmental	Open in IMG/M
3300001104	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3	Environmental	Open in IMG/M
3300001140	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3	Environmental	Open in IMG/M
3300001158	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1	Environmental	Open in IMG/M
3300001305	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300001461	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3	Environmental	Open in IMG/M
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Host-Associated	Open in IMG/M
3300002158	Freshwater microbial communities from Lake Superior, Canada - Sta WM archaea	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300002653	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF135 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300002654	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF113 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300002669	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF128 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300002672	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF139 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300002681	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300002864	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_7 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300002865	Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300002907	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm	Environmental	Open in IMG/M
3300003316	Sugarcane root Sample L1	Host-Associated	Open in IMG/M
3300003505	Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)	Environmental	Open in IMG/M
3300003547	Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - QV1.1_AUG13 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300003551	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF147 (Metagenome Metatranscriptome, Counting Only)	Environmental	Open in IMG/M
3300003563	Grassland soil microbial communities from Hopland, California, USA - Sample H4_Bulk_46 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300003568	Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300003571	Grassland soil microbial communities from Hopland, California, USA - Sample H2_Bulk_35 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300003574	Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300003715	Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - N08B_Dec13 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300003717	Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_9 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300003735	Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300003845	Agave microbial communities from Guanajuato, Mexico - At.P.e	Host-Associated	Open in IMG/M
3300003848	Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz	Host-Associated	Open in IMG/M
3300003850	Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz	Host-Associated	Open in IMG/M
3300003857	Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz	Host-Associated	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004118	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF208 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004134	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF248 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004137	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004473	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004505	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 29 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004606	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004607	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004609	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004610	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 12 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004613	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004618	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300004785	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental	Open in IMG/M
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005661	Agave microbial communities from Guanajuato, Mexico - As.Sf.e	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006020	Agave microbial communities from Guanajuato, Mexico - Mg.Sf.e	Host-Associated	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006316	Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000m	Environmental	Open in IMG/M
3300006357	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006688	Metatranscriptome of deep ocean microbial communities from South Indian Ocean - MP1089 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006794	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007526	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2012 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009144	Agave microbial communities from Guanajuato, Mexico - Or.Sf.e	Host-Associated	Open in IMG/M
3300009249	Microbial communities of water from Amazon river, Brazil - RCM15	Environmental	Open in IMG/M
3300009261	Microbial communities of water from Amazon river, Brazil - RCM23	Environmental	Open in IMG/M
3300009411	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009582	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009586	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010060	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010061	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010063	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010064	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010068	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010071	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010075	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010076	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010079	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010080	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010081	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010083	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010084	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010086	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010088	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010090	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010096	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010097	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010105	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010106	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010107	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010111	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010114	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010116	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010123	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010125	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010128	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010132	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010136	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010144	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010146	Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010147	Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300010161	Combined Assembly of Pinova apple microbial communities from Belgium	Environmental	Open in IMG/M
3300010192	Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum fallax MT (Eukaryote Community Metatranscriptome)	Host-Associated	Open in IMG/M
3300010200	Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)	Host-Associated	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010395	Agave microbial communities from Guanajuato, Mexico - Or.Ma.e	Host-Associated	Open in IMG/M
3300010855	Boreal forest soil eukaryotic communities from Alaska, USA - W1-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010857	Boreal forest soil eukaryotic communities from Alaska, USA - W1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010867	Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010870	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300010874	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3)	Environmental	Open in IMG/M
3300010878	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 7)	Environmental	Open in IMG/M
3300011072	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011074	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012364	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012373	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012374	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012376	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012380	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012383	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012385	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012388	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012389	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012392	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012393	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012395	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012397	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012401	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012403	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012671	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2	Environmental	Open in IMG/M
3300012722	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012723	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012757	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012888	Solar panel surface microbial communities from Lawrence Berkeley National Laboratory, California, USA - R	Engineered	Open in IMG/M
3300012902	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300013867	Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In5-11 gowning area SPAdes reassembly	Engineered	Open in IMG/M
3300013871	Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In4-11 gowning area SPAdes reassembly	Engineered	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017011	Metatranscriptome of marine eukaryotic communities from unknown location in f/4 medium with seawater, at 20 C, 34 psu salinity and 604 ?mol photons light - Paraphysomonas Imperforata PA2 (MMETSP0103)	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017446	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017946	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10	Environmental	Open in IMG/M
3300018012	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5	Environmental	Open in IMG/M
3300018414	Freshwater sediment microbial communities in response to fracking from North America - Little Laurel Run_MetaG_LLRF_2013	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018465	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300018587	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001485 (ERX1809474-ERR1739843)	Environmental	Open in IMG/M
3300018659	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)	Environmental	Open in IMG/M
3300018725	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)	Environmental	Open in IMG/M
3300018758	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002171 (ERX1782363-ERR1712059)	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300018949	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002172 (ERX1782262-ERR1712034)	Environmental	Open in IMG/M
3300019022	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)	Environmental	Open in IMG/M
3300019031	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)	Environmental	Open in IMG/M
3300019112	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)	Environmental	Open in IMG/M
3300019161	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019194	Soil microbial communities from Bohemian Forest, Czech Republic ? CSE1 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019228	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019238	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019244	Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019249	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019254	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019255	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019263	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019265	Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019887	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300019999	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1	Environmental	Open in IMG/M
3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020076	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3)	Environmental	Open in IMG/M
3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental	Open in IMG/M
3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental	Open in IMG/M
3300021273	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021849	Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021966	Food waste microbial community from Durham, Ontario, Canada - FW2 spades	Engineered	Open in IMG/M
3300021967	Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021982	Food waste microbial community from Durham, Ontario, Canada - FW1 spades	Engineered	Open in IMG/M
3300022465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022498	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022499	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022504	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022532	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022709	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022711	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022717	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022718	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022749	Metatranscriptome of freshwater microbial communities from Pennsylvania, United States - DR:GLUT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022891	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L136-409B-6	Environmental	Open in IMG/M
3300022894	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5	Environmental	Open in IMG/M
3300022903	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L001-104B-6	Environmental	Open in IMG/M
3300022904	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L166-409R-6	Environmental	Open in IMG/M
3300022910	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6	Environmental	Open in IMG/M
3300022911	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5	Environmental	Open in IMG/M
3300023076	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L088-202R-2	Environmental	Open in IMG/M
3300023104	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L044-104R-1	Environmental	Open in IMG/M
3300023280	Combined Assembly of Gp0238881, Gp0242115	Engineered	Open in IMG/M
3300023541	Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023666	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300023697	Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17_Aug_MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024288	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal	Environmental	Open in IMG/M
3300024342	Metatranscriptome of sheep rumen microbial communities from Palmerston North, Manawatu-Wanganui, New Zealand - 1742 RNA GHGhigh gp2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300024483	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024487	Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental	Open in IMG/M
3300026493	Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0937-MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300027037	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes)	Environmental	Open in IMG/M
3300027075	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT160D0 HiSeq	Environmental	Open in IMG/M
3300027504	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)	Environmental	Open in IMG/M
3300027513	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)	Environmental	Open in IMG/M
3300027619	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)	Environmental	Open in IMG/M
3300027663	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)	Environmental	Open in IMG/M
3300027718	Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes)	Host-Associated	Open in IMG/M
3300027737	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)	Environmental	Open in IMG/M
3300027765	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)	Environmental	Open in IMG/M
3300027809	Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes)	Host-Associated	Open in IMG/M
3300028140	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028170	Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0744-MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028181	Metatranscriptome of enriched soil aggregate microbial communities from Iowa State University, Ames, United States - MC6-MC0762-MT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028237	Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Reed Canary Grass, Gen10, Rep 2, Chloramphenicol (External Submission)	Host-Associated	Open in IMG/M
3300028246	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028554	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (v9)	Environmental	Open in IMG/M
3300028588	Plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T30	Environmental	Open in IMG/M
3300028709	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118	Environmental	Open in IMG/M
3300030514	Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2)	Host-Associated	Open in IMG/M
3300030515	Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (v2)	Host-Associated	Open in IMG/M
3300030531	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030537	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb7 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030546	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb11 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030551	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030555	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab7 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030563	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030571	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030574	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030576	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb9 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030596	Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO085SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030608	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb4 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030682	Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb11 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030692	Agave microbial communities from Guanajuato, Mexico - As.Sf.e (v2)	Host-Associated	Open in IMG/M
3300030738	Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly	Environmental	Open in IMG/M
3300030758	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300030768	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T30 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030779	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 EcM (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030784	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 6A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030789	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030792	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030793	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030794	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030798	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T0 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030807	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030809	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030820	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T28 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030822	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T21 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030827	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T28 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030851	Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 SO (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030858	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 6B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030860	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-1A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030861	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 4C (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030885	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030889	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030891	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T26 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030896	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T24 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030902	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030903	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030926	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T30 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030928	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T26 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030937	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300030938	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300030977	Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030978	Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA4 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030979	Forest soil microbial communities from France, for metatranscriptomics studies - Site 11 - Champenoux / Amance forest (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030984	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T23 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030988	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030989	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_197 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300030993	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031014	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031021	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031022	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300031026	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T25 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031055	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031058	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031074	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T13 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031075	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T11 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031082	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031086	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-2 (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031089	Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031091	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031099	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031102	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T9 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031105	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P1 T12 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031106	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T17 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031108	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P3 T15 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031109	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T12 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031114	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031116	Metatranscriptome of forest soil fungal communities from Los Alamos, New Mexico, United States - Jemez Pines Pi 5A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031123	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_196 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031263	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T9 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031422	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_181 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031446	Fir Summer Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031458	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T16 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031461	Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T8 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031505	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031869	Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300031872	Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU2 metaT (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032490	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032514	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental	Open in IMG/M
3300032550	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032590	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032592	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032757	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032758	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032760	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032781	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032790	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032812	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032821	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032822	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032823	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032824	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032826	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032845	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032889	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032913	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032914	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032915	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032916	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032966	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033523	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033525	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033531	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033532	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033533	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033536	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033537	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033538	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033542	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.22
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.22
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F002654

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign