NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010161

3300010161: Combined Assembly of Pinova apple microbial communities from Belgium



Overview

Basic Information
IMG/M Taxon OID3300010161 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117937 | Gp0154067 | Ga0136170
Sample NameCombined Assembly of Pinova apple microbial communities from Belgium
Sequencing StatusPermanent Draft
Sequencing CenterDNAVision
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size313044027
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameInsights Gained From Metagenomic Shotgun Sequencing Of Apple Fruit Epiphytic Microbiota
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Phyllosphere → Insights Gained From Metagenomic Shotgun Sequencing Of Apple Fruit Epiphytic Microbiota

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationBelgium
CoordinatesLat. (o)50.7699Long. (o)5.1579Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002654Metagenome / Metatranscriptome539Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0136170_1000211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1034Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0136170_1000211Ga0136170_10002111F002654LSEGQ**MLNYQTFNDKVGCQKGNSPEQVFKVPKFLLSESKEVFKRYNQEIGLEAAIF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.