NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001104

3300001104: Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3



Overview

Basic Information
IMG/M Taxon OID3300001104 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0071004 | Gp0053864 | Ga0002405
Sample NameForest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O3
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size4197826
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Multiple Locations In Canada And Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biomesolid layerforest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationEl Dorado National Forest, Georgetown, California, USA
CoordinatesLat. (o)38.88Long. (o)-120.64Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002654Metagenome / Metatranscriptome539Y
F016792Metagenome / Metatranscriptome244Y
F091057Metagenome / Metatranscriptome108Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI11756J13266_100175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1370Open in IMG/M
JGI11756J13266_100688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei634Open in IMG/M
JGI11756J13266_101002Not Available525Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI11756J13266_100175JGI11756J13266_1001751F002654MNNQTYNDKVVCLKGNSPEQVFKVPKLLLSENKEVFK*
JGI11756J13266_100688JGI11756J13266_1006881F091057FAVRPDGADHQWRRVPPXELSIALVADERFGRVTDWIEAS*
JGI11756J13266_101002JGI11756J13266_1010021F016792CVRPEGHRGGPHHPGDPQGSMMECPVREPCPPKCCYPDMRRSNPTCEAPGTTALLWKHQSGRGPAEDGRLNASERPWLRSVIENRPKVLTGRGQNGRRVGSSIVAVDDGGTVTRRTTGRNRPIRISTLDNRVSPIRPAARRYPDRKEGG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.