Basic Information | |
---|---|
IMG/M Taxon OID | 3300023104 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095510 | Gp0290975 | Ga0247805 |
Sample Name | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L044-104R-1 |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 655646112 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 2 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Type | Environmental |
Taxonomy | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts) |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | terrestrial biome → agricultural field → plant litter |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.3 | Long. (o) | -89.38 | Alt. (m) | N/A | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002654 | Metagenome / Metatranscriptome | 539 | Y |
F034190 | Metagenome / Metatranscriptome | 175 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0247805_1019129 | Not Available | 2691 | Open in IMG/M |
Ga0247805_1082372 | Not Available | 1188 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0247805_1019129 | Ga0247805_10191292 | F002654 | MLNYQTYNDKVVCQKGNSPEQVFKVPKYLLSESEEVFKLYNQELGLEAAIF |
Ga0247805_1082372 | Ga0247805_10823721 | F034190 | VLGVTYSAAGKQHFAALLVYEGGDSWLELQDCRAVGLTPFVGESAAFPHIWAVLQHFIDTRSALLNGDWCFLNAVLGLMAPSATHPCPICIVSKSNLLSTSRYRTPADKHSIDRTHQPLLTIPPERIVPTPLHLFLGISNRIILDAFSELLGKERVEAALKSITTIHSAGCSGAADLHDLNGPEISKWIKKECSATLLSAAAAASAVTDAIAASHSTLTRWLQQLHHCLLRSGDWSAADIDAWRSVVSDIHQHWCAETSQKAFPKLHMLHHSIDFAERHRFLGRASEAQIESCHAFFNSLVHKQHRNQSGNTAERLRRCLADASLRAVQPLLQP |
⦗Top⦘ |