Protein Family IF13705
Metagenome
Isolate
228
Members
198
Samples
85
Scaffolds
343.56
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8021546568|8021546799|
- Length
- 387 aa
- Sequence
- VMKLSEDSPGNWGITEPGSDDTLTRLTLALDVMGGDFGPSVTVPAALQALNSNSQLTLLLVGDPDAITPLLAKADFEQRSRLQIIPAQSVIASDARPAQAIRSSRGSSMRVALELVKEGRAQACVSAGNTGALMGLAKLLLKPIEGIERPALVTVLPHQQKGKTVVLDLGANVDCDSTMLVQFAVMGAVLAEEVVGIANPRVALLNIGEEEMKGLGSIRDAAAVLKTLPSLNYIGYLEANELLTGKTDVLVCDGFTGNVTLKTMEGVVRMFLSLLKSQGEGKKRSWWLLLLKRWLQKSLARRFSHLNPDQYNGACLLGLRGSVIKSHGAANQRAFSVAIEQAVQAVQRQIPQRIAARLESLYPAGFELPESDSDVNARQQSGTNGHD
Sample Types
Isolate
62.7%
Metagenome
37.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
19.2%
Anthocoridae
10.4%
Drosophilidae
10.4%
Termitidae
9.8%
Muscidae
6.7%
Curculionidae
5.2%
Calliphoridae
4.7%
Kalotermitidae
4.7%
Culicidae
3.1%
Tenebrionidae
3.1%
Aphididae
2.6%
Tephritidae
2.6%
Cerambycidae
2.1%
Apidae
1.6%
Pteromalidae
1.6%
Sarcophagidae
1.0%
Rhinotermitidae
1.0%
Pentatomidae
1.0%
Passalidae
1.0%
Armadillidiidae
1.0%
Formicidae
1.0%
Ceratophyllidae
0.5%
Daphniidae
0.5%
Aphrophoridae
0.5%
Thripidae
0.5%
Anthomyiidae
0.5%
Hippoboscidae
0.5%
Rhopalidae
0.5%
Reduviidae
0.5%
Glossinidae
0.5%
Carabidae
0.5%
Crambidae
0.5%
Cicadellidae
0.5%
Taxonomy
Archaea
0
Bacteria
220
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 2 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 3 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 4 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 5 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 6 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 7 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 8 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 9 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 10 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 11 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 12 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 13 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 14 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 15 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 20 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 21 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 22 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 23 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 24 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 25 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 26 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 27 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 28 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 29 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 30 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 31 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 32 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 33 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 34 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 35 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 36 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 48 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 49 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 50 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 51 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 52 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 53 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 54 | 2958255616 | Serratia marcescens TM | Isolate | |
| 55 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 56 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 57 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 58 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 59 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 60 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 61 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 62 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 63 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 64 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 65 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 66 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 67 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 68 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 69 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 70 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 71 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 72 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 73 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 74 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 75 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 76 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 77 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 78 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 79 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 80 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 81 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 82 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 83 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 84 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 85 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 86 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 87 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 88 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 89 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 90 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 91 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 92 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 93 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 94 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 95 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 96 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 97 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 98 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 99 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 100 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 101 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 102 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 103 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 104 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 105 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 106 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 107 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 108 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 109 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 110 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 111 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 112 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 113 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 114 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 115 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 116 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 117 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 118 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 119 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 120 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 121 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 122 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 123 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 124 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 125 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 126 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 127 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 128 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 129 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 130 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 131 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 132 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 133 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 134 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 135 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 136 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 137 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 138 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 139 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 140 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 141 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 142 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 143 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 144 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 145 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 146 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 147 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 148 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 149 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 150 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 151 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 152 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 153 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 154 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 155 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 156 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 157 | 2984883310 | Serratia symbiotica SCifornacula/2912 | Isolate | Aphididae |
| 158 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 159 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 160 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 161 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 162 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 163 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 164 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 165 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 166 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 167 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 168 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 169 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 170 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 171 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 172 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 173 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 174 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 175 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 176 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 177 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 178 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 179 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 180 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 181 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 182 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 183 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 184 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 185 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 186 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 187 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 188 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 189 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 190 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 191 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 192 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 193 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 194 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 195 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 196 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 197 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 198 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 2 | DPOL_contig05772 | 2035918003 | Bacteria | 3787 |
| 3 | Ga0104049_1131393 | 3300007103 | Unclassified | 2595 |
| 4 | Ga0265387_1002360 | 3300024582 | Bacteria | 2669 |
| 5 | Ga0466657_010114 | 3300042582 | Bacteria | 4381 |
| 6 | Ga0466701_009809 | 3300042598 | Bacteria | 41352 |
| 7 | Ga0123353_10634081 | 3300010167 | Bacteria | 1518 |
| 8 | Ga0466723_136822 | 3300042618 | Bacteria | 12504 |
| 9 | Ga0466703_280493 | 3300042636 | Bacteria | 7782 |
| 10 | Ga0466724_05253 | 3300042649 | Bacteria | 37771 |
| 11 | Ga0466724_50619 | 3300042649 | Bacteria | 61999 |
| 12 | Ga0466713_089586 | 3300042602 | Bacteria | 4495 |
| 13 | Ga0466719_494823 | 3300042606 | Bacteria | 7576 |
| 14 | Ga0562377_0082 | 3300056842 | Bacteria | 346138 |
| 15 | JGI24705J35276_12234976 | 3300002504 | Bacteria | 6048 |
| 16 | CVPL010L_1001722 | 3300002932 | Unclassified | 4897 |
| 17 | Ga0105005_1082070 | 3300007505 | Bacteria | 8423 |
| 18 | Ga0160456_102651 | 3300012820 | Bacteria | 3141 |
| 19 | Ga0466657_010966 | 3300042582 | Bacteria | 29326 |
| 20 | Ga0123355_10010093 | 3300009826 | Bacteria | 14431 |
| 21 | Ga0123353_10327474 | 3300010167 | Bacteria | 2321 |
| 22 | Ga0466728_197039 | 3300042620 | Bacteria | 33942 |
| 23 | Ga0466734_097305 | 3300042623 | Bacteria | 4866 |
| 24 | Ga0466730_041266 | 3300042625 | Unclassified | 4065 |
| 25 | Ga0466730_099822 | 3300042625 | Bacteria | 30039 |
| 26 | Ga0466704_116057 | 3300042643 | Bacteria | 7019 |
| 27 | Ga0466724_47330 | 3300042649 | Bacteria | 4384 |
| 28 | Ga0466724_52552 | 3300042649 | Bacteria | 241703 |
| 29 | Ga0466707_183043 | 3300042601 | Bacteria | 46436 |
| 30 | Ga0466722_095779 | 3300042609 | Bacteria | 12603 |
| 31 | FGTW_contig05376 | 2065487013 | Bacteria | 3872 |
| 32 | 2227080787 | 2225789004 | Bacteria | 142991 |
| 33 | HBC_ctgsDRAFT_1005390 | 3300000333 | Bacteria | 2993 |
| 34 | JGI24695J34938_10062745 | 3300002450 | Bacteria | 1577 |
| 35 | Meta3P_1001095 | 3300002464 | Bacteria | 32510 |
| 36 | Ga0104147_1012804 | 3300007224 | Bacteria | 10917 |
| 37 | Ga0466705_405999 | 3300042612 | Unclassified | 2066 |
| 38 | Ga0466730_029967 | 3300042625 | Bacteria | 3861 |
| 39 | Ga0466703_227153 | 3300042636 | Bacteria | 10801 |
| 40 | Ga0466704_077709 | 3300042643 | Bacteria | 3493 |
| 41 | Ga0466708_011361 | 3300042652 | Unclassified | 4257 |
| 42 | Ga0466713_052057 | 3300042602 | Bacteria | 69837 |
| 43 | Ga0466733_175091 | 3300042659 | Bacteria | 58462 |
| 44 | Ga0562377_0215 | 3300056842 | Bacteria | 144945 |
| 45 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 46 | Ga0104050_1026234 | 3300007153 | Bacteria | 5213 |
| 47 | Ga0160436_1007795 | 3300012861 | Bacteria | 2434 |
| 48 | Ga0123355_10511368 | 3300009826 | Bacteria | 1475 |
| 49 | Ga0123353_10166843 | 3300010167 | Bacteria | 3499 |
| 50 | Ga0466705_199363 | 3300042612 | Bacteria | 11967 |
| 51 | Ga0466712_233056 | 3300042614 | Unclassified | 1325 |
| 52 | Ga0466723_078994 | 3300042618 | Bacteria | 4277 |
| 53 | Ga0466724_37450 | 3300042649 | Bacteria | 2797 |
| 54 | Ga0466719_008199 | 3300042606 | Bacteria | 1834 |
| 55 | Ga0063521_1000381 | 3300003973 | Bacteria | 25187 |
| 56 | Ga0265387_1000029 | 3300024582 | Bacteria | 55272 |
| 57 | Ga0466697_263855 | 3300042611 | Bacteria | 4542 |
| 58 | Ga0466711_335248 | 3300042615 | Bacteria | 29031 |
| 59 | IMNBL1DRAFT_c0000200 | 3300000062 | Bacteria | 52540 |
| 60 | JGI24702J35022_10002832 | 3300002462 | Bacteria | 10504 |
| 61 | JGI24702J35022_10016024 | 3300002462 | Bacteria | 4116 |
| 62 | Ga0127645_101894 | 3300009461 | Bacteria | 19040 |
| 63 | Ga0160444_103682 | 3300012841 | Unclassified | 2156 |
| 64 | Ga0466692_114364 | 3300042591 | Bacteria | 16144 |
| 65 | Ga0123356_10013626 | 3300010049 | Bacteria | 7837 |
| 66 | Ga0466715_210466 | 3300042616 | Bacteria | 34126 |
| 67 | Ga0466717_072676 | 3300042604 | Bacteria | 7069 |
| 68 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 69 | HBC_ctgsDRAFT_1003172 | 3300000333 | Bacteria | 3762 |
| 70 | CVPL010L_1001065 | 3300002932 | Bacteria | 4427 |
| 71 | Ga0074188_1000239 | 3300005318 | Bacteria | 35603 |
| 72 | Ga0316159_12546 | 3300030930 | Unclassified | 1903 |
| 73 | Ga0123355_10293071 | 3300009826 | Bacteria | 2230 |
| 74 | Ga0123356_10118328 | 3300010049 | Bacteria | 2572 |
| 75 | Ga0123354_10001850 | 3300010882 | Bacteria | 26748 |
| 76 | Ga0466730_090888 | 3300042625 | Bacteria | 3594 |
| 77 | Ga0562374_0136 | 3300057007 | Bacteria | 182707 |
| 78 | Ga0063521_1000002 | 3300003973 | Bacteria | 391466 |
| 79 | Ga0063521_1000023 | 3300003973 | Bacteria | 132266 |
| 80 | Ga0063521_1000098 | 3300003973 | Bacteria | 69691 |
| 81 | Ga0105553_1074911 | 3300007767 | Bacteria | 8072 |
| 82 | Ga0123357_10000219 | 3300009784 | Bacteria | 54155 |
| 83 | Ga0466710_108458 | 3300042613 | Bacteria | 43285 |
| 84 | Ga0466728_274894 | 3300042620 | Bacteria | 1982 |
| 85 | Ga0466725_275200 | 3300042654 | Bacteria | 66856 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02504 | FA_synthesis | Fatty acid synthesis protein | 27 | 353 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.