Protein Family IF13695
Metagenome
Isolate
325
Members
265
Samples
113
Scaffolds
383.46
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8021535516|8021538865|
- Length
- 410 aa
- Sequence
- VMIISAASDYRAAAQRILPPFLFHYIDGGAYAEHTLRRNVEDLSDVALRQRILRNMSDLSLETTLFNEKLAMPTALAPVGLCGMYARRGEVQAAGAADEKGIPFTLSTVSVCPIEEVAPTIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMRRYWQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLANNFDPSISWKDLEWIRDFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGDITILADSGIRNGLDVVRMIALGADSVLLGRAYLYALATHGKQGVANLLNLIEKEMKVAMTLTGAKTIGEISRESLVQNADALRTFDTIAAGNPAVTPLPQGEGTVRQAG
Sample Types
Isolate
65.2%
Metagenome
34.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.0%
Curculionidae
8.3%
Apidae
7.9%
Elmidae
7.5%
Drosophilidae
7.5%
Culicidae
5.5%
Anthocoridae
5.5%
Muscidae
5.1%
Formicidae
3.9%
Armadillidiidae
3.1%
Tenebrionidae
2.8%
Calliphoridae
2.4%
Cerambycidae
1.6%
Palinuridae
1.2%
Termitidae
1.2%
Talitridae
1.2%
Tephritidae
1.2%
Aphididae
0.8%
Sarcophagidae
0.8%
Plutellidae
0.8%
Kalotermitidae
0.4%
Trigoniulidae
0.4%
Nephropidae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Stratiomyidae
0.4%
Pediculidae
0.4%
Artemiidae
0.4%
Rhopalidae
0.4%
Penaeidae
0.4%
Carabidae
0.4%
Passalidae
0.4%
Crambidae
0.4%
Pentatomidae
0.4%
Noctuidae
0.4%
Taxonomy
Archaea
0
Bacteria
292
Eukaryota
0
Viruses
0
Unclassified
33
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 2 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 3 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 4 | 2868677537 | Acetobacter orientalis DsW_061 | Isolate | Drosophilidae |
| 5 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 6 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 7 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 8 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 9 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 10 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 11 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 12 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 13 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 14 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 15 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 16 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 17 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 18 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 19 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 20 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 21 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 22 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 23 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 26 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 27 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 28 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 29 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 30 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 31 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 32 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 33 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 34 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 35 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 36 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 37 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 38 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 39 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 40 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 41 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 42 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 43 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 44 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 45 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 46 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 47 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 48 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 49 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 50 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 51 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 52 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 53 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 54 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 55 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 56 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 57 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 58 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 59 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 60 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 61 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 62 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 63 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 64 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 65 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 66 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 67 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 68 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 69 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 70 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 71 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 72 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 73 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 74 | 2958255616 | Serratia marcescens TM | Isolate | |
| 75 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 76 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 77 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 78 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 79 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 80 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 81 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 82 | 2987037630 | Oecophyllibacter saccharovorans Ha5 | Isolate | Formicidae |
| 83 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 84 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 85 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 86 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 87 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 88 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 89 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 90 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 91 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 92 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 93 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 94 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 95 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 96 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 97 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 98 | 2837008993 | Oecophyllibacter saccharovorans Ta1 | Isolate | Formicidae |
| 99 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 100 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 101 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 102 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 103 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 104 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 105 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 106 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 107 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 108 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 109 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 110 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 111 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 112 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 113 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 114 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 115 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 116 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 117 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 118 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 119 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 120 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 121 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 122 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 123 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 124 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 125 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 126 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 127 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 128 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 129 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 130 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 131 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 132 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 133 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 134 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 135 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 136 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 137 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 138 | 2843073756 | Oecophyllibacter saccharovorans Jb2 | Isolate | Formicidae |
| 139 | 2858129007 | Acetobacter orientalis DmW_045 | Isolate | Drosophilidae |
| 140 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 141 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 142 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 143 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 144 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 145 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 146 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 147 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 148 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 149 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 150 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 151 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 152 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 153 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 154 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 155 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 156 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 157 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 158 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 159 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 160 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 161 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 162 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 163 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 164 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 165 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 166 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 167 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 168 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 169 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 170 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 171 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 172 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 173 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 174 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 175 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 176 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 177 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 178 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 179 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 180 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 181 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 182 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 183 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 184 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 185 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 186 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 187 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 188 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 189 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 190 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 191 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 192 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 193 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 194 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 195 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 196 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 197 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 198 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 199 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 200 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 201 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 202 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 203 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 204 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 205 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 206 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 207 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 208 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 209 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 210 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 211 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 212 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 213 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 214 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 215 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 216 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 217 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 218 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 219 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 220 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 221 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 222 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 223 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 224 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 225 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 226 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 227 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 228 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 229 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 230 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 231 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 232 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 233 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 234 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 235 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 236 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 237 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 238 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 239 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 240 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 241 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 242 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 243 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 244 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 245 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 246 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 247 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 248 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 249 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 250 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 251 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 252 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 253 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 254 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 255 | 3300007763 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 5 gut | Metagenome | Drosophilidae |
| 256 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 257 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 258 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 259 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 260 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 261 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 262 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 263 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 264 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 265 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160448_100004 | 3300012854 | Bacteria | 543831 |
| 2 | Ga0160436_1000400 | 3300012861 | Unclassified | 17879 |
| 3 | Ga0160464_100042 | 3300012805 | Bacteria | 158320 |
| 4 | DPO_contig06485 | 2032320009 | Bacteria | 22524 |
| 5 | DPOL_contig16667 | 2035918003 | Bacteria | 8187 |
| 6 | FGTW_contig30603 | 2065487013 | Unclassified | 14471 |
| 7 | FGTW_contig31138 | 2065487013 | Unclassified | 5820 |
| 8 | Ga0063521_1000461 | 3300003973 | Bacteria | 20220 |
| 9 | Ga0466730_086275 | 3300042625 | Bacteria | 21913 |
| 10 | Ga0466701_021641 | 3300042598 | Bacteria | 2720 |
| 11 | Ga0160468_102361 | 3300012819 | Bacteria | 3317 |
| 12 | Ga0160467_101639 | 3300012829 | Unclassified | 7669 |
| 13 | Ga0160433_101376 | 3300012846 | Bacteria | 6835 |
| 14 | Ga0160443_100351 | 3300012848 | Unclassified | 40263 |
| 15 | Ga0160434_100032 | 3300012850 | Bacteria | 120271 |
| 16 | Ga0265387_1000003 | 3300024582 | Bacteria | 117657 |
| 17 | 2227080775 | 2225789004 | Bacteria | 185106 |
| 18 | Ga0074188_1000166 | 3300005318 | Bacteria | 22045 |
| 19 | Ga0074278_102054 | 3300005721 | Unclassified | 3660 |
| 20 | Ga0104042_1124306 | 3300007130 | Bacteria | 1347 |
| 21 | Ga0105005_1033650 | 3300007505 | Bacteria | 22198 |
| 22 | Ga0105553_1034859 | 3300007767 | Bacteria | 16515 |
| 23 | Ga0466730_019458 | 3300042625 | Bacteria | 29293 |
| 24 | Ga0466730_038275 | 3300042625 | Bacteria | 118226 |
| 25 | Ga0466730_096820 | 3300042625 | Bacteria | 1639 |
| 26 | Ga0466709_133990 | 3300042648 | Bacteria | 11930 |
| 27 | Ga0466724_61258 | 3300042649 | Bacteria | 49653 |
| 28 | Ga0466724_64720 | 3300042649 | Unclassified | 9652 |
| 29 | Ga0466713_118458 | 3300042602 | Unclassified | 4911 |
| 30 | Ga0160447_101225 | 3300012849 | Bacteria | 10228 |
| 31 | Ga0160447_106601 | 3300012849 | Bacteria | 3040 |
| 32 | Ga0466701_009865 | 3300042598 | Unclassified | 6641 |
| 33 | DPOL_contig13356 | 2035918003 | Bacteria | 18953 |
| 34 | FGTW_contig30609 | 2065487013 | Unclassified | 14109 |
| 35 | Ga0063521_1000004 | 3300003973 | Bacteria | 302382 |
| 36 | Ga0104045_1004098 | 3300007085 | Unclassified | 3511 |
| 37 | Ga0104019_1000880 | 3300007150 | Unclassified | 11395 |
| 38 | Ga0466724_09152 | 3300042649 | Bacteria | 67157 |
| 39 | Ga0466701_047342 | 3300042598 | Bacteria | 38450 |
| 40 | Ga0466701_056260 | 3300042598 | Bacteria | 79986 |
| 41 | Ga0466701_093982 | 3300042598 | Bacteria | 93695 |
| 42 | Ga0466707_053720 | 3300042601 | Unclassified | 3292 |
| 43 | Ga0160459_100066 | 3300012831 | Bacteria | 153495 |
| 44 | Ga0160472_100207 | 3300012839 | Bacteria | 73284 |
| 45 | Ga0265387_1000272 | 3300024582 | Bacteria | 8716 |
| 46 | Ga0247290_01219 | 3300035364 | Unclassified | 3129 |
| 47 | Ga0247290_01340 | 3300035364 | Unclassified | 2895 |
| 48 | DPOL_contig13154 | 2035918003 | Bacteria | 10007 |
| 49 | CVPL005L_10000759 | 3300002938 | Bacteria | 44780 |
| 50 | Ga0063521_1000043 | 3300003973 | Bacteria | 109392 |
| 51 | Ga0105008_1000090 | 3300007507 | Bacteria | 9315 |
| 52 | Ga0105004_1000359 | 3300007763 | Bacteria | 6579 |
| 53 | Ga0466730_101593 | 3300042625 | Bacteria | 20614 |
| 54 | Ga0466724_27194 | 3300042649 | Bacteria | 71240 |
| 55 | Ga0466724_37906 | 3300042649 | Bacteria | 9615 |
| 56 | Ga0160432_100112 | 3300012818 | Unclassified | 79517 |
| 57 | Ga0160433_100090 | 3300012846 | Bacteria | 92891 |
| 58 | Ga0160445_101418 | 3300012847 | Unclassified | 6868 |
| 59 | Ga0160443_100071 | 3300012848 | Bacteria | 195428 |
| 60 | Ga0160443_101860 | 3300012848 | Unclassified | 5814 |
| 61 | Ga0160447_109523 | 3300012849 | Bacteria | 2221 |
| 62 | Ga0160457_1000018 | 3300012858 | Bacteria | 380116 |
| 63 | Ga0247289_1261 | 3300035363 | Unclassified | 2486 |
| 64 | DPO_contig02470 | 2032320009 | Unclassified | 1307 |
| 65 | CVPL010L_1001186 | 3300002932 | Unclassified | 6637 |
| 66 | Ga0102737_1006761 | 3300007142 | Bacteria | 2148 |
| 67 | Ga0103264_1001735 | 3300007188 | Unclassified | 9681 |
| 68 | Ga0105005_1026197 | 3300007505 | Unclassified | 2393 |
| 69 | Ga0466730_019409 | 3300042625 | Bacteria | 16821 |
| 70 | Ga0466730_092902 | 3300042625 | Bacteria | 57909 |
| 71 | Ga0466724_05376 | 3300042649 | Bacteria | 20153 |
| 72 | Ga0466724_25059 | 3300042649 | Bacteria | 104497 |
| 73 | Ga0466724_34583 | 3300042649 | Bacteria | 9824 |
| 74 | Ga0466713_041448 | 3300042602 | Bacteria | 72943 |
| 75 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 76 | Ga0160433_100002 | 3300012846 | Bacteria | 625007 |
| 77 | Ga0160435_1001451 | 3300012857 | Bacteria | 6003 |
| 78 | Ga0316159_13246 | 3300030930 | Bacteria | 2828 |
| 79 | DPO_contig01682 | 2032320009 | Bacteria | 26719 |
| 80 | Meta3P_1000387 | 3300002464 | Bacteria | 19942 |
| 81 | CVPL010W_10020333 | 3300002931 | Unclassified | 3841 |
| 82 | Ga0103264_1000302 | 3300007188 | Bacteria | 30164 |
| 83 | Ga0466730_046856 | 3300042625 | Bacteria | 68730 |
| 84 | Ga0466730_083580 | 3300042625 | Bacteria | 69041 |
| 85 | Ga0466724_44605 | 3300042649 | Bacteria | 9926 |
| 86 | Ga0160446_100027 | 3300012835 | Bacteria | 172758 |
| 87 | Ga0160444_100160 | 3300012841 | Bacteria | 66483 |
| 88 | FGTW_contig10441 | 2065487013 | Unclassified | 3512 |
| 89 | Meta3P_1000328 | 3300002464 | Bacteria | 80534 |
| 90 | CVPL005W_1000132 | 3300002934 | Bacteria | 31589 |
| 91 | Ga0105004_1030953 | 3300007763 | Bacteria | 13228 |
| 92 | Ga0466724_07645 | 3300042649 | Unclassified | 8952 |
| 93 | Ga0466724_18825 | 3300042649 | Unclassified | 20437 |
| 94 | Ga0466701_029669 | 3300042598 | Bacteria | 117911 |
| 95 | Ga0466701_032975 | 3300042598 | Unclassified | 2930 |
| 96 | Ga0466713_085715 | 3300042602 | Bacteria | 93291 |
| 97 | Ga0562378_0079 | 3300056814 | Bacteria | 269445 |
| 98 | Ga0562375_0004 | 3300056856 | Bacteria | 3010592 |
| 99 | Ga0160469_104846 | 3300012824 | Bacteria | 1494 |
| 100 | Ga0160436_1001613 | 3300012861 | Unclassified | 6068 |
| 101 | Ga0466701_004040 | 3300042598 | Bacteria | 78940 |
| 102 | Ga0466701_008105 | 3300042598 | Unclassified | 179505 |
| 103 | SPBB_contig00020 | 2044078006 | Bacteria | 147933 |
| 104 | CVPL010L_1000032 | 3300002932 | Bacteria | 56777 |
| 105 | Ga0063521_1000186 | 3300003973 | Bacteria | 45070 |
| 106 | Ga0074188_1000366 | 3300005318 | Bacteria | 38922 |
| 107 | Ga0102737_1000671 | 3300007142 | Unclassified | 10869 |
| 108 | Ga0104147_1027306 | 3300007224 | Bacteria | 5720 |
| 109 | Ga0105005_1276553 | 3300007505 | Bacteria | 2979 |
| 110 | Ga0105004_1073531 | 3300007763 | Unclassified | 2579 |
| 111 | Ga0466730_012123 | 3300042625 | Bacteria | 56347 |
| 112 | Ga0466730_096004 | 3300042625 | Bacteria | 122670 |
| 113 | Ga0466707_117997 | 3300042601 | Unclassified | 3563 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01070 | FMN_dh | FMN-dependent dehydrogenase | 14 | 376 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01070 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.