Protein Family IF13480
Metagenome
Metatranscriptome
Isolate
506
Members
373
Samples
214
Scaffolds
239.9
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|639279309|639314238|
- Length
- 264 aa
- Sequence
- MCKRFVMVQFFLPKNSKINKNGEVYNAPENAKNVKCFKIYRWSPDDDSNPRIDTFFIDLDQCGQMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNIDGTNTLACTKAISDIKSDVEIYPLPHMNVIKDLVPDLSNFYKQYESITPWMQAEEPSHNKERLQSIEDRSKLDGVYDCILCACCSTSCPSYWWNPDKYLGPAALLQVYRWLIDSRDEASDKRLDMLDDAFKLYRCHTIMNCTNTCPKGLNPAKAIADIKQMMVRR
Sample Types
Isolate
57.7%
Metagenome
42.1%
MAG
0.0%
Metatranscriptome
0.2%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
20.3%
Apidae
19.4%
Unclassified
10.8%
Termitidae
7.5%
Drosophilidae
6.4%
Formicidae
5.6%
Ixodidae
4.7%
Culicidae
4.2%
Kalotermitidae
3.6%
Elmidae
3.3%
Psyllidae
1.1%
Sarcophagidae
1.1%
Argasidae
1.1%
Termopsidae
1.1%
Rhinotermitidae
1.1%
Curculionidae
0.8%
Armadillidiidae
0.8%
Berytidae
0.6%
Pulicidae
0.6%
Aphididae
0.6%
Hydrophilidae
0.6%
Alydidae
0.6%
Largidae
0.6%
Tenebrionidae
0.3%
Tephritidae
0.3%
Pseudococcidae
0.3%
Pteromalidae
0.3%
Delphacidae
0.3%
Cimicidae
0.3%
Silvanidae
0.3%
Ceratopogonidae
0.3%
Cylisticidae
0.3%
Crambidae
0.3%
Carposinidae
0.3%
Passalidae
0.3%
Hodotermitidae
0.3%
Taxonomy
Archaea
0
Bacteria
458
Eukaryota
0
Viruses
0
Unclassified
48
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2209111014 | Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP | Metagenome | Psyllidae |
| 2 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 3 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 4 | 2721755752 | Wolbachia endosymbiont of Drosophila incompta wInc_Cu | Isolate | Drosophilidae |
| 5 | 2811995359 | Rickettsia bellii An04 | Isolate | Ixodidae |
| 6 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 7 | 2832201259 | Rickettsiella grylli TrM1 | Isolate | Unclassified |
| 8 | 2834326310 | Wolbachia endosymbiont of Drosophila ananassae wAna_India | Isolate | Drosophilidae |
| 9 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 10 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 11 | 2840963544 | Wolbachia endosymbiont of Nomada leucophthalma wNleu | Isolate | Apidae |
| 12 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 13 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 14 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 15 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 16 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 17 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 18 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 19 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 20 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 21 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 22 | 638341234 | Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24 | Isolate | Drosophilidae |
| 23 | 640753044 | Rickettsia bellii OSU 85-389 | Isolate | Ixodidae |
| 24 | 642979308 | Wolbachia endosymbiont of Culex quinquefasciatus JHB | Isolate | Culicidae |
| 25 | 643692055 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 26 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 27 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 28 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 29 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 30 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 31 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 32 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 33 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 34 | 3300060778 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_PS_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 35 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 2513237285 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 41 | 2585427698 | Occidentia massiliensis OS118 | Isolate | Unclassified |
| 42 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 43 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 44 | 2811994999 | Candidatus Rickettsia amblyommii An13 | Isolate | Ixodidae |
| 45 | 2512047014 | Acetobacter tropicalis B1.3 | Isolate | Tephritidae |
| 46 | 2834762790 | Rickettsia fournieri AUS118 | Isolate | Unclassified |
| 47 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 48 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 49 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 50 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 51 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 52 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 53 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 54 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 55 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 56 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 57 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 58 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 59 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 60 | 2871564055 | Francisella tularensis holarctica FT9C-G7 | Isolate | Ixodidae |
| 61 | 2874203443 | Francisella tularensis holarctica FT8C-4F | Isolate | Ixodidae |
| 62 | 2884844624 | Wolbachia endosymbiont of Ctenocephalides felis wCfeJ | Isolate | Pulicidae |
| 63 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 64 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 65 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 66 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 67 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 68 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 69 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 70 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 71 | 638341178 | Rickettsia sibirica 246 | Isolate | Unclassified |
| 72 | 639279309 | Ehrlichia ruminantium Welgevonden, CIRAD | Isolate | Unclassified |
| 73 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 74 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 75 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 76 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 77 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 78 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 79 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 80 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 81 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 82 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 83 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 84 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 85 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 86 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 87 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 88 | 650716082 | Rickettsia conorii heilongjiangensis 054 | Isolate | Pseudococcidae |
| 89 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 90 | 2513237282 | Wolbachia endosymbiont wVitB of Nasonia vitripennis | Isolate | Pteromalidae |
| 91 | 2540341171 | Wolbachia endosymbiont of Drosophila simulans wHa | Isolate | Drosophilidae |
| 92 | 2547132200 | Wolbachia sp (Diaphorina citri) | Isolate | Psyllidae |
| 93 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 94 | 2588253760 | Wolbachia endosymbiont wPip_Mol of Culex molestus | Isolate | Culicidae |
| 95 | 2718218151 | Rickettsia rickettsii Iowa Large Clone | Isolate | Ixodidae |
| 96 | 2788500057 | Francisella-like endosymbiont F-Om | Isolate | Argasidae |
| 97 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 98 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 99 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 100 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 101 | 2619619280 | Wolbachia pipientis wAu | Isolate | Drosophilidae |
| 102 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 103 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 104 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 105 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 106 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 107 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 108 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 109 | 2868683769 | Acetobacter sp. DmW_043 | Isolate | Drosophilidae |
| 110 | 2871595141 | Francisella tularensis 503 | Isolate | Ixodidae |
| 111 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 112 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 113 | 2896342394 | Wolbachia endosymbiont of Nilaparvata lugens wLug | Isolate | Delphacidae |
| 114 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 115 | 3300009459 | Microbial communities of aphids from Hamamelis virginiana in Wilton, CT, USA - Hamamelistes spinosus NM072310_02 seqcov | Metagenome | |
| 116 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 117 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 118 | 637000340 | Wolbachia endosymbiont TRS of Brugia malayi | Isolate | Unclassified |
| 119 | 641228503 | Rickettsia massiliae MTU5 | Isolate | Ixodidae |
| 120 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 121 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 122 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 123 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 124 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 125 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 126 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 127 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 128 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 129 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 130 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 131 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 132 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 133 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 134 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 135 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 136 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 137 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 138 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 139 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 140 | 2565956547 | Candidatus Profftella armatura | Isolate | Psyllidae |
| 141 | 2568526663 | Wolbachia pipientis wMelPop | Isolate | Drosophilidae |
| 142 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 143 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 144 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 145 | 2772190782 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 146 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 147 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 148 | 2840666718 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 149 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 150 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 151 | 2843484624 | Wolbachia endosymbiont of Nomada ferruginata wNfe | Isolate | Apidae |
| 152 | 2845988041 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 153 | 2845999109 | Wolbachia endosymbiont of Nomada flava wNfla | Isolate | Apidae |
| 154 | 2846015620 | Wolbachia sp. wMel_KL | Isolate | Drosophilidae |
| 155 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 156 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 157 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 158 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 159 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 160 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 161 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 162 | 3002821025 | Wolbachia endosymbiont of Pentalonia nigronervosa WolPenNig | Isolate | Aphididae |
| 163 | 3002825763 | Candidatus Wolbachia massiliensis PL13 | Isolate | Cimicidae |
| 164 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 165 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 166 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 167 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 168 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 169 | 2993991113 | Shikimatogenerans silvanidophilus JKI-2014 | Isolate | Silvanidae |
| 170 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 171 | 642555168 | Wolbachia endosymbiont of Culex quinquefasciatus Pel | Isolate | Culicidae |
| 172 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 173 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 174 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 175 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 176 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 177 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 178 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 179 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 180 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 181 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 182 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 183 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 184 | 2718218474 | Wolbachia endosymbiont of Drosophila incompta wInc_SM | Isolate | Drosophilidae |
| 185 | 2791354884 | Francisella endosymbiont of Amblyomma maculatum FLE-Am | Isolate | Ixodidae |
| 186 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 187 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 188 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 189 | 2511231061 | Rickettsia slovaca 13-B | Isolate | Ixodidae |
| 190 | 2548876922 | Rickettsia sibirica mongolitimonae HA-91 | Isolate | Ixodidae |
| 191 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 192 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 193 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 194 | 2834764525 | Rickettsia endosymbiont of Culicoides newsteadi RiCNE | Isolate | Ceratopogonidae |
| 195 | 2845997892 | Wolbachia sp. wMel_AMD | Isolate | Drosophilidae |
| 196 | 2846025955 | Wolbachia endosymbiont of Cylisticus convexus Wcon | Isolate | Cylisticidae |
| 197 | 2846028689 | Wolbachia endosymbiont of Nomada panzeri wNpa | Isolate | Apidae |
| 198 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 199 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 200 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 201 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 202 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 203 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 204 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 205 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 206 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 207 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 208 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 209 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 210 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 211 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 212 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 213 | 638341232 | Wolbachia endosymbiont of Drosophila ananassae | Isolate | Drosophilidae |
| 214 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 215 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 216 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 217 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 218 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 219 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 220 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 221 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 222 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 223 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 224 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 225 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 226 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 227 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 228 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 229 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 230 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 231 | 2540341172 | Wolbachia endosymbiont of Drosophila simulans wNo | Isolate | Drosophilidae |
| 232 | 2562617066 | Rickettsiella grylli AAQJ | Isolate | Armadillidiidae |
| 233 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 234 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 235 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 236 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 237 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 238 | 2834852038 | Acetobacter cibinongensis DsW_47 | Isolate | Drosophilidae |
| 239 | 2843491798 | Wolbachia endosymbiont of Drosophila ananassae wAna_Hawaii | Isolate | Drosophilidae |
| 240 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 241 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 242 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 243 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 244 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 245 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 246 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 247 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 248 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 249 | 2858105562 | Acetobacter sp. DsW_059 | Isolate | Drosophilidae |
| 250 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 251 | 2884841417 | Wolbachia endosymbiont of Carposina sasakii wCauA | Isolate | Carposinidae |
| 252 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 253 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 254 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 255 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 256 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 257 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 258 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 259 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 260 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 261 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 262 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 263 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 264 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 265 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 266 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 267 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 268 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 269 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 270 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 271 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 272 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 273 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 274 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 275 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 276 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 277 | 2548876780 | Rickettsia sibirica BJ-90 | Isolate | Ixodidae |
| 278 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 279 | 2773857880 | Candidatus Profftella armatura YCPA | Isolate | Psyllidae |
| 280 | 2791354885 | Francisella endosymbiont of Ornithodoros moubata FLE-Om | Isolate | Argasidae |
| 281 | 2806310685 | Francisella persica ATCC VR-331 | Isolate | Argasidae |
| 282 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 283 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 284 | 2744054723 | Ehrlichia ruminantium Palm River | Isolate | Unclassified |
| 285 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 286 | 2854576727 | Acetobacter okinawensis DsW_060 | Isolate | Drosophilidae |
| 287 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 288 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 289 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 290 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 291 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 292 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 293 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 294 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 295 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 296 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 297 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 298 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 299 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 300 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 301 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 302 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 303 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 304 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 305 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 306 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 307 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 308 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 309 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 310 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 311 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 312 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 313 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 314 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 315 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 316 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 317 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 318 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 319 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 320 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 321 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 322 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 323 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 324 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 325 | 2506210010 | Francisella tularensis tularensis FSC041 | Isolate | |
| 326 | 2506210015 | Francisella tularensis holarctica FSC185 | Isolate | |
| 327 | 2517572215 | Wolbachia endosymbiont of Drosophila suzukii wSuzi | Isolate | Drosophilidae |
| 328 | 2718217968 | Rickettsia rickettsii Iowa Small Clone | Isolate | Ixodidae |
| 329 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 330 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 331 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 332 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 333 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 334 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 335 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 336 | 2848715743 | Wolbachia endosymbiont of Drosophila ananassae wAna_Indonesia | Isolate | Drosophilidae |
| 337 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 338 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 339 | 2874209778 | Francisella tularensis holarctica FT16C-B1 | Isolate | Ixodidae |
| 340 | 2884843004 | Wolbachia endosymbiont of Ctenocephalides felis wCfeT | Isolate | Pulicidae |
| 341 | 2896279687 | Wolbachia endosymbiont of Cardiocondyla obscurior wCobs-BR2009-alpha | Isolate | Formicidae |
| 342 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 343 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 344 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 345 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 346 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 347 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 348 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 349 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 350 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 351 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 352 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 353 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 354 | 639279308 | Ehrlichia ruminantium Welgevonden, ARC-OVI | Isolate | Unclassified |
| 355 | 644736402 | Rickettsia africae ESF-5 | Isolate | Ixodidae |
| 356 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 357 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 358 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 359 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 360 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 361 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 362 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 363 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 364 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 365 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 366 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 367 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 368 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 369 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 370 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 371 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 372 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 373 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466698_400724 | 3300042610 | Bacteria | 9581 |
| 2 | Ga0309904_1001909 | 3300029810 | Unclassified | 2562 |
| 3 | Ga0466657_102255 | 3300042582 | Bacteria | 1778 |
| 4 | Ga0466657_368175 | 3300042582 | Bacteria | 2690 |
| 5 | Ga0466690_102554 | 3300042590 | Bacteria | 9043 |
| 6 | Ga0466693_299453 | 3300042592 | Bacteria | 2826 |
| 7 | Ga0160471_101751 | 3300012812 | Bacteria | 4008 |
| 8 | Ga0466710_213102 | 3300042613 | Bacteria | 5313 |
| 9 | Ga0466715_267881 | 3300042616 | Unclassified | 1586 |
| 10 | Ga0466723_157718 | 3300042618 | Bacteria | 2093 |
| 11 | Ga0466728_356098 | 3300042620 | Bacteria | 19383 |
| 12 | CVPL010W_10002730 | 3300002931 | Unclassified | 21683 |
| 13 | CVPL010W_10011160 | 3300002931 | Bacteria | 7557 |
| 14 | CVPL010W_10017136 | 3300002931 | Unclassified | 4770 |
| 15 | CVPL005L_10000395 | 3300002938 | Bacteria | 60313 |
| 16 | Ga0103260_1000581 | 3300007139 | Unclassified | 6957 |
| 17 | Ga0102740_1001090 | 3300007140 | Unclassified | 7110 |
| 18 | Ga0102738_1002086 | 3300007141 | Bacteria | 3018 |
| 19 | Ga0103264_1001061 | 3300007188 | Bacteria | 12217 |
| 20 | Ga0103264_1001197 | 3300007188 | Bacteria | 29629 |
| 21 | Ga0466731_120623 | 3300042622 | Bacteria | 2535 |
| 22 | Ga0466734_164013 | 3300042623 | Bacteria | 1022 |
| 23 | Ga0466702_274542 | 3300042635 | Bacteria | 7480 |
| 24 | Ga0466703_247687 | 3300042636 | Bacteria | 9843 |
| 25 | Ga0466724_16999 | 3300042649 | Bacteria | 89252 |
| 26 | Ga0466708_288440 | 3300042652 | Bacteria | 29694 |
| 27 | Ga0466725_098465 | 3300042654 | Bacteria | 4740 |
| 28 | Ga0466727_216807 | 3300042655 | Bacteria | 44188 |
| 29 | Ga0466701_073291 | 3300042598 | Bacteria | 1680 |
| 30 | Ga0466701_081415 | 3300042598 | Bacteria | 4563 |
| 31 | Ga0466707_048457 | 3300042601 | Bacteria | 6711 |
| 32 | Ga0466717_218906 | 3300042604 | Bacteria | 5456 |
| 33 | Ga0160470_102160 | 3300012813 | Bacteria | 3906 |
| 34 | Ga0160456_100002 | 3300012820 | Bacteria | 798475 |
| 35 | Ga0160458_102918 | 3300012832 | Unclassified | 2229 |
| 36 | Ga0160446_101276 | 3300012835 | Bacteria | 5693 |
| 37 | Ga0160472_100011 | 3300012839 | Bacteria | 434772 |
| 38 | Ga0466657_286197 | 3300042582 | Unclassified | 1318 |
| 39 | Ga0466692_024957 | 3300042591 | Bacteria | 31579 |
| 40 | Ga0466710_313516 | 3300042613 | Bacteria | 80423 |
| 41 | Ga0466710_352632 | 3300042613 | Bacteria | 1550 |
| 42 | Ga0466726_205611 | 3300042619 | Bacteria | 1613 |
| 43 | 2217959588 | 2209111014 | Bacteria | 2986 |
| 44 | CVPL005L_10000357 | 3300002938 | Bacteria | 44612 |
| 45 | Ga0072941_1045250 | 3300005201 | Bacteria | 14816 |
| 46 | Ga0103266_1000005 | 3300007067 | Bacteria | 128947 |
| 47 | Ga0103266_1000256 | 3300007067 | Unclassified | 13706 |
| 48 | Ga0103260_1006077 | 3300007139 | Unclassified | 1752 |
| 49 | Ga0102737_1008997 | 3300007142 | Unclassified | 1736 |
| 50 | Ga0103264_1000391 | 3300007188 | Bacteria | 23031 |
| 51 | Ga0105524_107174 | 3300007733 | Unclassified | 2193 |
| 52 | Ga0127649_144118 | 3300009460 | Unclassified | 2042 |
| 53 | Ga0466725_119406 | 3300042654 | Bacteria | 15154 |
| 54 | Ga0466697_256741 | 3300042611 | Bacteria | 5701 |
| 55 | Ga0466706_079434 | 3300042599 | Bacteria | 1351 |
| 56 | Ga0466698_032355 | 3300042610 | Bacteria | 6484 |
| 57 | Ga0160467_100033 | 3300012829 | Bacteria | 240135 |
| 58 | Ga0160447_108425 | 3300012849 | Unclassified | 2469 |
| 59 | Ga0466657_105890 | 3300042582 | Unclassified | 4363 |
| 60 | Ga0466691_013659 | 3300042593 | Bacteria | 13291 |
| 61 | Ga0123355_10578681 | 3300009826 | Bacteria | 1343 |
| 62 | Ga0160465_100274 | 3300012803 | Bacteria | 34985 |
| 63 | Ga0466710_094058 | 3300042613 | Bacteria | 1265 |
| 64 | Ga0466712_183550 | 3300042614 | Bacteria | 10591 |
| 65 | JGI24702J35022_10007371 | 3300002462 | Bacteria | 6309 |
| 66 | JGI24696J40584_12943094 | 3300002834 | Unclassified | 1762 |
| 67 | CVPL010W_10001027 | 3300002931 | Bacteria | 31990 |
| 68 | Ga0102736_1004852 | 3300007052 | Bacteria | 2292 |
| 69 | Ga0103265_1006856 | 3300007068 | Unclassified | 1527 |
| 70 | Ga0102734_1009332 | 3300007129 | Bacteria | 2683 |
| 71 | Ga0102740_1000968 | 3300007140 | Unclassified | 7691 |
| 72 | Ga0103264_1000049 | 3300007188 | Bacteria | 66894 |
| 73 | Ga0103264_1000563 | 3300007188 | Bacteria | 18411 |
| 74 | Ga0127656_101980 | 3300009453 | Bacteria | 42715 |
| 75 | Ga0466725_262889 | 3300042654 | Bacteria | 41201 |
| 76 | Ga0466706_144982 | 3300042599 | Bacteria | 11683 |
| 77 | Ga0466707_219669 | 3300042601 | Bacteria | 10492 |
| 78 | Ga0466720_044020 | 3300042607 | Unclassified | 7080 |
| 79 | Ga0466722_113836 | 3300042609 | Bacteria | 15035 |
| 80 | Ga0160456_100487 | 3300012820 | Bacteria | 12511 |
| 81 | Ga0160447_110487 | 3300012849 | Bacteria | 2030 |
| 82 | Ga0466657_229608 | 3300042582 | Bacteria | 2617 |
| 83 | Ga0466690_370639 | 3300042590 | Unclassified | 2050 |
| 84 | Ga0466695_062260 | 3300042595 | Unclassified | 2475 |
| 85 | Ga0160466_103358 | 3300012809 | Unclassified | 2665 |
| 86 | Ga0466710_034197 | 3300042613 | Bacteria | 2890 |
| 87 | Ga0466710_075542 | 3300042613 | Bacteria | 2624 |
| 88 | Ga0466711_357432 | 3300042615 | Bacteria | 11548 |
| 89 | IMNBGM34_c000002 | 3300000036 | Bacteria | 76957 |
| 90 | CVPL010W_10000504 | 3300002931 | Bacteria | 64250 |
| 91 | Ga0103265_1000464 | 3300007068 | Bacteria | 8384 |
| 92 | Ga0103261_1003028 | 3300007083 | Bacteria | 2626 |
| 93 | Ga0103264_1000347 | 3300007188 | Bacteria | 24731 |
| 94 | Ga0103267_1000696 | 3300007190 | Unclassified | 13903 |
| 95 | Ga0103268_1000273 | 3300007192 | Unclassified | 16996 |
| 96 | Ga0105005_1001999 | 3300007505 | Bacteria | 6025 |
| 97 | Ga0105524_101631 | 3300007733 | Bacteria | 2352 |
| 98 | Ga0127655_1011324 | 3300009459 | Unclassified | 1694 |
| 99 | Ga0466734_100732 | 3300042623 | Bacteria | 2081 |
| 100 | Ga0466730_016549 | 3300042625 | Bacteria | 55510 |
| 101 | Ga0466704_453241 | 3300042643 | Unclassified | 10708 |
| 102 | Ga0466708_082966 | 3300042652 | Unclassified | 2169 |
| 103 | Ga0466725_013951 | 3300042654 | Bacteria | 9132 |
| 104 | Ga0466701_022884 | 3300042598 | Bacteria | 48643 |
| 105 | Ga0466701_044464 | 3300042598 | Bacteria | 300143 |
| 106 | Ga0466717_207750 | 3300042604 | Bacteria | 8643 |
| 107 | Ga0466721_399246 | 3300042608 | Bacteria | 1675 |
| 108 | Ga0160459_100631 | 3300012831 | Bacteria | 12606 |
| 109 | Ga0160436_1006253 | 3300012861 | Unclassified | 2772 |
| 110 | Ga0466657_236896 | 3300042582 | Unclassified | 5881 |
| 111 | Ga0466657_241304 | 3300042582 | Bacteria | 1094 |
| 112 | Ga0466657_259182 | 3300042582 | Bacteria | 1147 |
| 113 | Ga0466691_022671 | 3300042593 | Bacteria | 25970 |
| 114 | Ga0123357_10376586 | 3300009784 | Unclassified | 1323 |
| 115 | Ga0123354_10009451 | 3300010882 | Bacteria | 14930 |
| 116 | Ga0466710_359587 | 3300042613 | Bacteria | 1473 |
| 117 | Ga0466715_255878 | 3300042616 | Bacteria | 7467 |
| 118 | Ga0466718_152516 | 3300042617 | Bacteria | 3937 |
| 119 | Ga0466723_021240 | 3300042618 | Bacteria | 16287 |
| 120 | JGI24705J35276_12198613 | 3300002504 | Bacteria | 1572 |
| 121 | CVPL010W_10010199 | 3300002931 | Bacteria | 8226 |
| 122 | CVPL010W_10016898 | 3300002931 | Bacteria | 4844 |
| 123 | Ga0102735_1000361 | 3300007080 | Bacteria | 17184 |
| 124 | Ga0127649_117880 | 3300009460 | Unclassified | 11103 |
| 125 | Ga0123357_10000011 | 3300009784 | Bacteria | 173575 |
| 126 | Ga0466731_032250 | 3300042622 | Unclassified | 11598 |
| 127 | Ga0466734_040458 | 3300042623 | Bacteria | 7862 |
| 128 | Ga0466735_019498 | 3300042624 | Bacteria | 9631 |
| 129 | Ga0466708_289596 | 3300042652 | Bacteria | 26550 |
| 130 | Ga0466708_295954 | 3300042652 | Bacteria | 2325 |
| 131 | Ga0466707_249841 | 3300042601 | Bacteria | 26414 |
| 132 | Ga0466713_114856 | 3300042602 | Bacteria | 19907 |
| 133 | Ga0466717_259214 | 3300042604 | Bacteria | 2414 |
| 134 | Ga0466719_005820 | 3300042606 | Bacteria | 4151 |
| 135 | Ga0466719_022057 | 3300042606 | Bacteria | 4143 |
| 136 | Ga0466719_032187 | 3300042606 | Bacteria | 9908 |
| 137 | Ga0466719_062869 | 3300042606 | Bacteria | 4130 |
| 138 | Ga0160460_105738 | 3300012845 | Unclassified | 1752 |
| 139 | Ga0160436_1030209 | 3300012861 | Bacteria | 930 |
| 140 | Ga0466695_400989 | 3300042595 | Bacteria | 2516 |
| 141 | Ga0123354_10065488 | 3300010882 | Bacteria | 5316 |
| 142 | Ga0160454_100645 | 3300012798 | Bacteria | 8143 |
| 143 | Ga0466710_027649 | 3300042613 | Bacteria | 19021 |
| 144 | Ga0466715_016375 | 3300042616 | Bacteria | 2857 |
| 145 | Ga0466715_263107 | 3300042616 | Bacteria | 32267 |
| 146 | Ga0102739_1000521 | 3300007095 | Unclassified | 7629 |
| 147 | Ga0102734_1001896 | 3300007129 | Bacteria | 5072 |
| 148 | Ga0103264_1000319 | 3300007188 | Bacteria | 26150 |
| 149 | Ga0105005_1027884 | 3300007505 | Bacteria | 7172 |
| 150 | Ga0123357_10000259 | 3300009784 | Bacteria | 50415 |
| 151 | Ga0466734_024358 | 3300042623 | Bacteria | 4249 |
| 152 | Ga0466734_055508 | 3300042623 | Bacteria | 2235 |
| 153 | Ga0466734_128965 | 3300042623 | Bacteria | 16161 |
| 154 | Ga0466730_070127 | 3300042625 | Bacteria | 1204 |
| 155 | Ga0466703_200433 | 3300042636 | Bacteria | 92642 |
| 156 | Ga0466704_129264 | 3300042643 | Bacteria | 53504 |
| 157 | Ga0466725_093203 | 3300042654 | Bacteria | 2482 |
| 158 | Ga0466725_109315 | 3300042654 | Bacteria | 8488 |
| 159 | Ga0466697_123862 | 3300042611 | Bacteria | 2579 |
| 160 | Ga0466701_096949 | 3300042598 | Bacteria | 149718 |
| 161 | Ga0466707_200801 | 3300042601 | Bacteria | 11286 |
| 162 | Ga0466719_283709 | 3300042606 | Unclassified | 3235 |
| 163 | Ga0160447_102788 | 3300012849 | Bacteria | 5949 |
| 164 | Ga0160448_107883 | 3300012854 | Bacteria | 2495 |
| 165 | Ga0466690_023646 | 3300042590 | Bacteria | 18908 |
| 166 | Ga0466692_121513 | 3300042591 | Bacteria | 18425 |
| 167 | Ga0466701_001468 | 3300042598 | Unclassified | 5073 |
| 168 | Ga0466710_020270 | 3300042613 | Bacteria | 3363 |
| 169 | Ga0466710_158857 | 3300042613 | Bacteria | 50604 |
| 170 | Ga0466726_448390 | 3300042619 | Bacteria | 10106 |
| 171 | 2217624423 | 2209111014 | Bacteria | 29542 |
| 172 | JGI24705J35276_12230832 | 3300002504 | Bacteria | 3752 |
| 173 | WW0001_100107 | 3300002732 | Bacteria | 26150 |
| 174 | Ga0068302_10051423 | 3300005071 | Bacteria | 4512 |
| 175 | Ga0072941_1190886 | 3300005201 | Bacteria | 7964 |
| 176 | Ga0103263_100218 | 3300007042 | Bacteria | 8967 |
| 177 | Ga0102735_1000596 | 3300007080 | Unclassified | 7509 |
| 178 | Ga0102739_1008081 | 3300007095 | Unclassified | 1386 |
| 179 | Ga0102734_1004225 | 3300007129 | Unclassified | 4074 |
| 180 | Ga0103264_1000688 | 3300007188 | Bacteria | 20808 |
| 181 | Ga0103264_1001695 | 3300007188 | Bacteria | 17495 |
| 182 | Ga0466730_007701 | 3300042625 | Bacteria | 130976 |
| 183 | Ga0466709_023565 | 3300042648 | Unclassified | 37293 |
| 184 | Ga0466724_46658 | 3300042649 | Bacteria | 5858 |
| 185 | Ga0466708_064045 | 3300042652 | Bacteria | 19560 |
| 186 | Ga0466725_054587 | 3300042654 | Bacteria | 1884 |
| 187 | Ga0466705_171973 | 3300042612 | Bacteria | 113809 |
| 188 | Ga0466733_034941 | 3300042659 | Bacteria | 5548 |
| 189 | Ga0590802_07970 | 3300060778 | Bacteria | 861 |
| 190 | Ga0466716_096937 | 3300042605 | Bacteria | 1369 |
| 191 | Ga0466719_410071 | 3300042606 | Bacteria | 22415 |
| 192 | Ga0120204_000012 | 3300038942 | Unclassified | 9118 |
| 193 | Ga0466656_182080 | 3300042550 | Unclassified | 11289 |
| 194 | Ga0466657_093586 | 3300042582 | Bacteria | 1201 |
| 195 | Ga0466657_202829 | 3300042582 | Bacteria | 3998 |
| 196 | Ga0466657_249609 | 3300042582 | Bacteria | 7532 |
| 197 | Ga0123357_10274272 | 3300009784 | Unclassified | 1756 |
| 198 | Ga0123353_10000232 | 3300010167 | Bacteria | 70042 |
| 199 | Ga0160442_100011 | 3300012806 | Bacteria | 474135 |
| 200 | Ga0466729_060751 | 3300042621 | Bacteria | 49540 |
| 201 | SCG598J21_12956 | 3300000475 | Bacteria | 195512 |
| 202 | CVPL005L_10009215 | 3300002938 | Unclassified | 8585 |
| 203 | Ga0102737_1003249 | 3300007142 | Unclassified | 3778 |
| 204 | Ga0102737_1003427 | 3300007142 | Unclassified | 4977 |
| 205 | Ga0104050_1000057 | 3300007153 | Bacteria | 3323 |
| 206 | Ga0103268_1002164 | 3300007192 | Unclassified | 4482 |
| 207 | Ga0104147_1001735 | 3300007224 | Unclassified | 10296 |
| 208 | Ga0466734_111034 | 3300042623 | Bacteria | 8871 |
| 209 | Ga0466730_013812 | 3300042625 | Bacteria | 185537 |
| 210 | Ga0466703_038680 | 3300042636 | Bacteria | 18312 |
| 211 | Ga0466709_109378 | 3300042648 | Bacteria | 9163 |
| 212 | Ga0466708_071854 | 3300042652 | Bacteria | 2719 |
| 213 | Ga0466725_000612 | 3300042654 | Bacteria | 5008 |
| 214 | Ga0466725_041366 | 3300042654 | Bacteria | 51248 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.