Protein Family IF13277
Metagenome
Isolate
304
Members
225
Samples
152
Scaffolds
335.52
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|3002031185|3002031532|
- Length
- 396 aa
- Sequence
- LFRIDRVVHETENFNSGNFESKQCEIVVFPDPEGPDKIIIFPFFIILPNFVLVNGKLSFYKNLYEMKLGIVGATGMVGRVMIDLLEKRNFPLKELYLSASEKSVDKELFFKKKVYKIISIYDLFLKKPDIVLFSSGSNVSKEWAPKFSDIGSIVIDNSSAWRMDSSKKLVVPEINASYLSEKDKIIANPNCSTIQLVMVLFPLHLEYEISRVIVSTYQSVTGTGKKALDQLDRERKKNGNCSFRVYPHPIYQNVIPHCDQFTDKGYTIEEMKLINETRKIMNDYNIAITATAVRVPVTGGHSESVNITFRKKPSINRIYEILSKRKGIIIQDHPKDDIYPMPLYAHGKDEIFVGRIREDFSFQNSINIWIVADNLRKGAATNTIQIAEYLIRKKYV
Sample Types
Isolate
50.0%
Metagenome
50.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
17.1%
Termitidae
11.0%
Drosophilidae
9.0%
Kalotermitidae
6.7%
Cryptocercidae
5.7%
Formicidae
5.2%
Elmidae
4.8%
Blaberidae
4.3%
Culicidae
3.3%
Blattellidae
3.3%
Psyllidae
2.4%
Armadillidiidae
2.4%
Pseudophyllodromiidae
1.9%
Cicadellidae
1.9%
Apidae
1.9%
Termopsidae
1.4%
Corydiidae
1.4%
Passalidae
1.0%
Pulicidae
1.0%
Ectobiidae
1.0%
Nyctiboridae
1.0%
Anaplectidae
1.0%
Blattidae
1.0%
Majidae
1.0%
Lysianassidae
0.5%
Hodotermitidae
0.5%
Aphrophoridae
0.5%
Pteromalidae
0.5%
Delphacidae
0.5%
Artemiidae
0.5%
Aphididae
0.5%
Nephropidae
0.5%
Silvanidae
0.5%
Lamproblattidae
0.5%
Cimicidae
0.5%
Rhinotermitidae
0.5%
Ixodidae
0.5%
Cylisticidae
0.5%
Tenebrionidae
0.5%
Tryonicidae
0.5%
Bombycidae
0.5%
Monophlebidae
0.5%
Carposinidae
0.5%
Cambaridae
0.5%
Taxonomy
Archaea
0
Bacteria
282
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 2 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 3 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 4 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 5 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 6 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 7 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 8 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 9 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 10 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 11 | 3002025727 | Blattabacterium cuenoti EUPHYsp | Isolate | Pseudophyllodromiidae |
| 12 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 13 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 14 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 15 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 16 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 17 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 646564518 | Candidatus Sulcia muelleri DMIN (unscreened) | Isolate | Cicadellidae |
| 25 | 648028014 | Candidatus Sulcia muelleri CARI | Isolate | Unclassified |
| 26 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 27 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2510917001 | Candidatus Sulcia muelleri PSPU | Isolate | Aphrophoridae |
| 32 | 2513237282 | Wolbachia endosymbiont wVitB of Nasonia vitripennis | Isolate | Pteromalidae |
| 33 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 34 | 2540341171 | Wolbachia endosymbiont of Drosophila simulans wHa | Isolate | Drosophilidae |
| 35 | 2547132200 | Wolbachia sp (Diaphorina citri) | Isolate | Psyllidae |
| 36 | 2588253760 | Wolbachia endosymbiont wPip_Mol of Culex molestus | Isolate | Culicidae |
| 37 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 38 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 39 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 40 | 2619619280 | Wolbachia pipientis wAu | Isolate | Drosophilidae |
| 41 | 2820032565 | Unclassified Saccharibacteria Th196P3bin19 | Isolate | Unclassified |
| 42 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 43 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 44 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 45 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 46 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 47 | 2896342394 | Wolbachia endosymbiont of Nilaparvata lugens wLug | Isolate | Delphacidae |
| 48 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 49 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 50 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 51 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 54 | 637000340 | Wolbachia endosymbiont TRS of Brugia malayi | Isolate | Unclassified |
| 55 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 56 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 57 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 58 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 59 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 60 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 61 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 62 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 63 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 64 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 65 | 2513237285 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 66 | 2718218185 | Candidatus Sulcia muelleri NC | Isolate | Cicadellidae |
| 67 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 68 | 2816332302 | Candidatus Liberibacter asiaticus YCPsy | Isolate | Psyllidae |
| 69 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 70 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 71 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 72 | 2884844624 | Wolbachia endosymbiont of Ctenocephalides felis wCfeJ | Isolate | Pulicidae |
| 73 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 74 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 75 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 76 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 77 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 78 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 79 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 80 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 81 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 82 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 83 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 84 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 85 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 86 | 2568526663 | Wolbachia pipientis wMelPop | Isolate | Drosophilidae |
| 87 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 88 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 89 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 90 | 2840666718 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 91 | 2843484624 | Wolbachia endosymbiont of Nomada ferruginata wNfe | Isolate | Apidae |
| 92 | 2845988041 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 93 | 2845999109 | Wolbachia endosymbiont of Nomada flava wNfla | Isolate | Apidae |
| 94 | 2846015620 | Wolbachia sp. wMel_KL | Isolate | Drosophilidae |
| 95 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 96 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 97 | 2993991113 | Shikimatogenerans silvanidophilus JKI-2014 | Isolate | Silvanidae |
| 98 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 99 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 100 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 101 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 102 | 3002825763 | Candidatus Wolbachia massiliensis PL13 | Isolate | Cimicidae |
| 103 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 104 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 105 | 642555168 | Wolbachia endosymbiont of Culex quinquefasciatus Pel | Isolate | Culicidae |
| 106 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 107 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 108 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 109 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 110 | 2517572215 | Wolbachia endosymbiont of Drosophila suzukii wSuzi | Isolate | Drosophilidae |
| 111 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 112 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 113 | 2884843004 | Wolbachia endosymbiont of Ctenocephalides felis wCfeT | Isolate | Pulicidae |
| 114 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 115 | 2896279687 | Wolbachia endosymbiont of Cardiocondyla obscurior wCobs-BR2009-alpha | Isolate | Formicidae |
| 116 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 117 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 118 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 119 | 2848715743 | Wolbachia endosymbiont of Drosophila ananassae wAna_Indonesia | Isolate | Drosophilidae |
| 120 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 121 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 122 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 123 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 124 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 125 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 126 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 127 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 128 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 129 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 130 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 131 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 132 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 133 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 134 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 135 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 136 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 137 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 138 | 2599185121 | Rickettsiales bacterium Ac37b | Isolate | Ixodidae |
| 139 | 2718218474 | Wolbachia endosymbiont of Drosophila incompta wInc_SM | Isolate | Drosophilidae |
| 140 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 141 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 142 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 143 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 144 | 2845997892 | Wolbachia sp. wMel_AMD | Isolate | Drosophilidae |
| 145 | 2846025955 | Wolbachia endosymbiont of Cylisticus convexus Wcon | Isolate | Cylisticidae |
| 146 | 2846028689 | Wolbachia endosymbiont of Nomada panzeri wNpa | Isolate | Apidae |
| 147 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 148 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 149 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 150 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 151 | 2820918931 | Unclassified Actinobacteria Emb289P3bin56 | Isolate | Unclassified |
| 152 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 153 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 154 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 155 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 156 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 157 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 158 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 159 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 160 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 161 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 162 | 641228484 | Candidatus Sulcia muelleri GWSS | Isolate | Cicadellidae |
| 163 | 644736336 | Candidatus Liberibacter asiaticus psy62 | Isolate | Psyllidae |
| 164 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 165 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 166 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 167 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 168 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 169 | 2209111014 | Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP | Metagenome | Psyllidae |
| 170 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 171 | 2599185120 | Candidatus Sulcia muelleri BGSS | Isolate | Cicadellidae |
| 172 | 2721755752 | Wolbachia endosymbiont of Drosophila incompta wInc_Cu | Isolate | Drosophilidae |
| 173 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 174 | 2834326310 | Wolbachia endosymbiont of Drosophila ananassae wAna_India | Isolate | Drosophilidae |
| 175 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 176 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 177 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 178 | 2840963544 | Wolbachia endosymbiont of Nomada leucophthalma wNleu | Isolate | Apidae |
| 179 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 180 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 181 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 182 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 183 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 184 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 185 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 186 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 187 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 188 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 189 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 190 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 191 | 642979308 | Wolbachia endosymbiont of Culex quinquefasciatus JHB | Isolate | Culicidae |
| 192 | 643692055 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 193 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 194 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 195 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 196 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 197 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 198 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 199 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 200 | 2540341172 | Wolbachia endosymbiont of Drosophila simulans wNo | Isolate | Drosophilidae |
| 201 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 202 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 203 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 204 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 205 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 206 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 207 | 2843491798 | Wolbachia endosymbiont of Drosophila ananassae wAna_Hawaii | Isolate | Drosophilidae |
| 208 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 209 | 2884841417 | Wolbachia endosymbiont of Carposina sasakii wCauA | Isolate | Carposinidae |
| 210 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 211 | 3002003370 | Blattabacterium cuenoti THEREAreg | Isolate | Corydiidae |
| 212 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 213 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 214 | 3002008367 | Blattabacterium cuenoti PARANAUcir | Isolate | Blaberidae |
| 215 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 216 | 3002028747 | Blattabacterium cuenoti ESCALves | Isolate | Blattellidae |
| 217 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 218 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 219 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 220 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 221 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 222 | 644736337 | Candidatus Sulcia muelleri SMDSEM | Isolate | Unclassified |
| 223 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 224 | 8063680480 | Candidatus Liberibacter asiaticus CoFLP | Isolate | Psyllidae |
| 225 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160445_101260 | 3300012847 | Bacteria | 7602 |
| 2 | Ga0160445_102364 | 3300012847 | Bacteria | 4392 |
| 3 | Ga0466690_150606 | 3300042590 | Bacteria | 6254 |
| 4 | Ga0466690_187065 | 3300042590 | Bacteria | 35023 |
| 5 | Ga0466707_034687 | 3300042601 | Bacteria | 2143 |
| 6 | Ga0466720_136830 | 3300042607 | Bacteria | 5605 |
| 7 | Ga0466698_201631 | 3300042610 | Bacteria | 1492 |
| 8 | IMNBL1DRAFT_c0016425 | 3300000062 | Bacteria | 3169 |
| 9 | JGI24702J35022_10052443 | 3300002462 | Bacteria | 2174 |
| 10 | Ga0102735_1007641 | 3300007080 | Bacteria | 1366 |
| 11 | Ga0103267_1000549 | 3300007190 | Bacteria | 11090 |
| 12 | Ga0466708_141238 | 3300042652 | Bacteria | 25411 |
| 13 | Ga0466728_342911 | 3300042620 | Unclassified | 4630 |
| 14 | Ga0466733_197153 | 3300042659 | Bacteria | 6477 |
| 15 | Ga0160458_100141 | 3300012832 | Bacteria | 66475 |
| 16 | Ga0160444_104067 | 3300012841 | Bacteria | 2022 |
| 17 | Ga0160433_100091 | 3300012846 | Bacteria | 91670 |
| 18 | Ga0160433_100586 | 3300012846 | Bacteria | 15419 |
| 19 | Ga0466693_170396 | 3300042592 | Bacteria | 5400 |
| 20 | Ga0123353_10070599 | 3300010167 | Bacteria | 5612 |
| 21 | Ga0160471_100019 | 3300012812 | Bacteria | 346491 |
| 22 | Ga0466698_232849 | 3300042610 | Bacteria | 1652 |
| 23 | 2217998891 | 2209111014 | Unclassified | 16098 |
| 24 | JGI24702J35022_10018121 | 3300002462 | Bacteria | 3842 |
| 25 | Ga0068302_10221987 | 3300005071 | Bacteria | 1303 |
| 26 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 27 | Ga0074308_1113557 | 3300005307 | Bacteria | 3427 |
| 28 | Ga0104045_1004576 | 3300007085 | Bacteria | 5797 |
| 29 | Ga0104041_1032553 | 3300007106 | Bacteria | 4198 |
| 30 | Ga0104048_1005552 | 3300007143 | Bacteria | 6545 |
| 31 | Ga0103268_1000083 | 3300007192 | Bacteria | 29500 |
| 32 | Ga0466735_017980 | 3300042624 | Bacteria | 22301 |
| 33 | Ga0466730_005120 | 3300042625 | Bacteria | 2971 |
| 34 | Ga0466703_171004 | 3300042636 | Bacteria | 3120 |
| 35 | Ga0466704_220031 | 3300042643 | Bacteria | 1906 |
| 36 | Ga0466704_487329 | 3300042643 | Bacteria | 3364 |
| 37 | Ga0466704_567480 | 3300042643 | Bacteria | 4936 |
| 38 | Ga0466711_156306 | 3300042615 | Bacteria | 3939 |
| 39 | Ga0466715_036389 | 3300042616 | Bacteria | 12166 |
| 40 | Ga0466723_091259 | 3300042618 | Bacteria | 10129 |
| 41 | Ga0466729_115484 | 3300042621 | Bacteria | 4721 |
| 42 | Ga0160445_100229 | 3300012847 | Bacteria | 40847 |
| 43 | Ga0309902_000125 | 3300028910 | Unclassified | 4173 |
| 44 | Ga0466690_042883 | 3300042590 | Unclassified | 2004 |
| 45 | Ga0466691_029437 | 3300042593 | Bacteria | 16222 |
| 46 | Ga0466696_449827 | 3300042596 | Unclassified | 2676 |
| 47 | Ga0123356_10016411 | 3300010049 | Bacteria | 7067 |
| 48 | Ga0466721_295426 | 3300042608 | Bacteria | 17983 |
| 49 | Ga0466721_390538 | 3300042608 | Bacteria | 1568 |
| 50 | Ga0466698_232927 | 3300042610 | Unclassified | 3569 |
| 51 | 2227480184 | 2225789004 | Bacteria | 78831 |
| 52 | Ga0074308_1018166 | 3300005307 | Bacteria | 9321 |
| 53 | Ga0104045_1002515 | 3300007085 | Bacteria | 4808 |
| 54 | Ga0104045_1009794 | 3300007085 | Bacteria | 3035 |
| 55 | Ga0104048_1000565 | 3300007143 | Bacteria | 3770 |
| 56 | Ga0103267_1001029 | 3300007190 | Unclassified | 7599 |
| 57 | Ga0127649_119052 | 3300009460 | Bacteria | 3405 |
| 58 | Ga0466731_138644 | 3300042622 | Bacteria | 2115 |
| 59 | Ga0466735_040097 | 3300042624 | Bacteria | 6186 |
| 60 | Ga0466709_374003 | 3300042648 | Unclassified | 4325 |
| 61 | Ga0466724_28891 | 3300042649 | Bacteria | 455231 |
| 62 | Ga0466724_67416 | 3300042649 | Unclassified | 21042 |
| 63 | Ga0466705_264757 | 3300042612 | Bacteria | 94140 |
| 64 | Ga0466711_384970 | 3300042615 | Bacteria | 6280 |
| 65 | Ga0466715_010929 | 3300042616 | Bacteria | 7691 |
| 66 | Ga0466726_255129 | 3300042619 | Bacteria | 3167 |
| 67 | Ga0466656_211276 | 3300042550 | Unclassified | 8329 |
| 68 | Ga0466690_208849 | 3300042590 | Bacteria | 5344 |
| 69 | Ga0466691_215708 | 3300042593 | Bacteria | 8921 |
| 70 | Ga0466695_138749 | 3300042595 | Bacteria | 16287 |
| 71 | Ga0466696_005733 | 3300042596 | Bacteria | 17522 |
| 72 | Ga0123355_10000370 | 3300009826 | Bacteria | 58074 |
| 73 | Ga0123354_10002360 | 3300010882 | Bacteria | 24800 |
| 74 | Ga0160466_100054 | 3300012809 | Bacteria | 144581 |
| 75 | Ga0466716_280275 | 3300042605 | Unclassified | 2413 |
| 76 | JGI24702J35022_10000692 | 3300002462 | Bacteria | 20608 |
| 77 | JGI24700J35501_10930355 | 3300002508 | Bacteria | 13278 |
| 78 | Ga0104045_1004880 | 3300007085 | Bacteria | 5033 |
| 79 | Ga0102737_1000002 | 3300007142 | Bacteria | 138174 |
| 80 | Ga0104019_1028134 | 3300007150 | Bacteria | 3442 |
| 81 | Ga0127649_100123 | 3300009460 | Bacteria | 51721 |
| 82 | Ga0466734_122538 | 3300042623 | Bacteria | 1252 |
| 83 | Ga0466735_144121 | 3300042624 | Bacteria | 16237 |
| 84 | Ga0466730_079745 | 3300042625 | Bacteria | 1875 |
| 85 | Ga0466703_039264 | 3300042636 | Bacteria | 69642 |
| 86 | Ga0466725_034289 | 3300042654 | Unclassified | 5473 |
| 87 | Ga0466725_396181 | 3300042654 | Bacteria | 1509 |
| 88 | Ga0466711_285333 | 3300042615 | Unclassified | 5923 |
| 89 | Ga0466711_455740 | 3300042615 | Bacteria | 4073 |
| 90 | Ga0466715_282440 | 3300042616 | Bacteria | 2394 |
| 91 | Ga0466723_044471 | 3300042618 | Bacteria | 37367 |
| 92 | Ga0466723_343076 | 3300042618 | Bacteria | 1676 |
| 93 | Ga0466726_299547 | 3300042619 | Bacteria | 32347 |
| 94 | Ga0466729_195701 | 3300042621 | Bacteria | 5689 |
| 95 | Ga0466733_109769 | 3300042659 | Bacteria | 2545 |
| 96 | Ga0160455_100062 | 3300012837 | Bacteria | 204480 |
| 97 | Ga0160444_100039 | 3300012841 | Bacteria | 198767 |
| 98 | Ga0466656_254643 | 3300042550 | Bacteria | 2336 |
| 99 | Ga0466657_174113 | 3300042582 | Bacteria | 1207 |
| 100 | Ga0466691_039688 | 3300042593 | Unclassified | 1637 |
| 101 | Ga0466701_006676 | 3300042598 | Unclassified | 10091 |
| 102 | Ga0123353_10167037 | 3300010167 | Bacteria | 3497 |
| 103 | Ga0466701_075478 | 3300042598 | Bacteria | 63169 |
| 104 | Ga0466706_226929 | 3300042599 | Bacteria | 24884 |
| 105 | JGI24700J35501_10930933 | 3300002508 | Bacteria | 64079 |
| 106 | Ga0102734_1000962 | 3300007129 | Bacteria | 12236 |
| 107 | Ga0466724_44804 | 3300042649 | Bacteria | 4647 |
| 108 | Ga0466705_386623 | 3300042612 | Bacteria | 4566 |
| 109 | Ga0466711_129175 | 3300042615 | Bacteria | 14854 |
| 110 | Ga0466723_188260 | 3300042618 | Bacteria | 20042 |
| 111 | Ga0466728_486102 | 3300042620 | Bacteria | 18544 |
| 112 | Ga0309904_1004297 | 3300029810 | Unclassified | 2100 |
| 113 | Ga0123354_10077986 | 3300010882 | Bacteria | 4713 |
| 114 | Ga0466707_163801 | 3300042601 | Bacteria | 828024 |
| 115 | Ga0466717_081696 | 3300042604 | Bacteria | 2277 |
| 116 | CVPL010W_10004528 | 3300002931 | Bacteria | 15396 |
| 117 | Ga0104045_1005697 | 3300007085 | Unclassified | 4059 |
| 118 | Ga0102740_1001327 | 3300007140 | Bacteria | 6339 |
| 119 | Ga0105524_103148 | 3300007733 | Bacteria | 5323 |
| 120 | Ga0466704_483685 | 3300042643 | Bacteria | 2345 |
| 121 | Ga0466725_142751 | 3300042654 | Bacteria | 5841 |
| 122 | Ga0466705_299019 | 3300042612 | Bacteria | 50692 |
| 123 | Ga0160455_100183 | 3300012837 | Bacteria | 61401 |
| 124 | Ga0160444_100028 | 3300012841 | Bacteria | 251262 |
| 125 | Ga0160433_100006 | 3300012846 | Bacteria | 359584 |
| 126 | Ga0466701_036771 | 3300042598 | Bacteria | 249987 |
| 127 | Ga0466707_169412 | 3300042601 | Bacteria | 13006 |
| 128 | Ga0466713_117396 | 3300042602 | Bacteria | 36879 |
| 129 | Ga0466719_542492 | 3300042606 | Unclassified | 1980 |
| 130 | WW0001_100226 | 3300002732 | Unclassified | 19038 |
| 131 | Ga0466731_328197 | 3300042622 | Unclassified | 5152 |
| 132 | Ga0466730_054806 | 3300042625 | Bacteria | 801523 |
| 133 | Ga0466703_361604 | 3300042636 | Bacteria | 2153 |
| 134 | Ga0466725_461122 | 3300042654 | Bacteria | 9117 |
| 135 | Ga0466715_338746 | 3300042616 | Bacteria | 4456 |
| 136 | Ga0466723_007785 | 3300042618 | Bacteria | 12457 |
| 137 | Ga0160468_100019 | 3300012819 | Bacteria | 312885 |
| 138 | Ga0123355_10055293 | 3300009826 | Unclassified | 6427 |
| 139 | Ga0123353_10003486 | 3300010167 | Bacteria | 19883 |
| 140 | Ga0466713_018212 | 3300042602 | Bacteria | 11888 |
| 141 | Ga0466713_069629 | 3300042602 | Bacteria | 17416 |
| 142 | Ga0466721_226083 | 3300042608 | Bacteria | 1718 |
| 143 | Ga0466721_395956 | 3300042608 | Bacteria | 1580 |
| 144 | JGI24697J35500_11271253 | 3300002507 | Bacteria | 4456 |
| 145 | Ga0068305_11081799 | 3300005083 | Bacteria | 1300 |
| 146 | Ga0102739_1000129 | 3300007095 | Bacteria | 21218 |
| 147 | Ga0104048_1169444 | 3300007143 | Bacteria | 2080 |
| 148 | Ga0104019_1001056 | 3300007150 | Bacteria | 26163 |
| 149 | Ga0104147_1023300 | 3300007224 | Unclassified | 1895 |
| 150 | Ga0466725_222007 | 3300042654 | Bacteria | 27431 |
| 151 | Ga0466705_383749 | 3300042612 | Bacteria | 32511 |
| 152 | Ga0466710_103523 | 3300042613 | Bacteria | 1500 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.