Protein Family IF13067
Metagenome
Isolate
352
Members
322
Samples
75
Scaffolds
155.37
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2940236825|2940237854|
- Length
- 163 aa
- Sequence
- MRYHNITKDDMLNGEGLRSVLWLAGCSHACKGCHNPVTWSLQGGLAFDEDAKAELFASLHHDYIDGVTLSGGDPLHPENRKDVHDLVKELKEKFPKKTIWLYTGYEYAEIVDLDLLAYIDVVVDGKFIEEQLSPNTHWVGSSNQKVIDVQASRALKQIVLYKE
Sample Types
Isolate
78.7%
Metagenome
21.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
36.7%
Unclassified
20.3%
Drosophilidae
6.1%
Anthocoridae
4.5%
Muscidae
4.2%
Tenebrionidae
3.2%
Curculionidae
3.2%
Calliphoridae
2.6%
Formicidae
2.3%
Culicidae
1.6%
Armadillidiidae
1.3%
Blattidae
1.3%
Cerambycidae
1.3%
Palinuridae
1.0%
Tephritidae
1.0%
Pteromalidae
1.0%
Elmidae
1.0%
Termitidae
0.6%
Talitridae
0.6%
Aphididae
0.6%
Sarcophagidae
0.6%
Pentatomidae
0.6%
Artemiidae
0.3%
Anthomyiidae
0.3%
Scarabaeidae
0.3%
Nephropidae
0.3%
Daphniidae
0.3%
Crambidae
0.3%
Siricidae
0.3%
Passalidae
0.3%
Majidae
0.3%
Carabidae
0.3%
Reduviidae
0.3%
Rhopalidae
0.3%
Penaeidae
0.3%
Plutellidae
0.3%
Taxonomy
Archaea
0
Bacteria
325
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 2 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 3 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 4 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 5 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 6 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 7 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 8 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 9 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 10 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 11 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 12 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 13 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 14 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 15 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 16 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 17 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 18 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 19 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 20 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 21 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 22 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 23 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 24 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 25 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 26 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 27 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 28 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 29 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 30 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 31 | 2958255616 | Serratia marcescens TM | Isolate | |
| 32 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 33 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 34 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 35 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 36 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 37 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 38 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 39 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 40 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 41 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 42 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 43 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 44 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 45 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 46 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 47 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 48 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 49 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 50 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 51 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 52 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 53 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 54 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 55 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 56 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 57 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 58 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 59 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 60 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 61 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 62 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 63 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 64 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 65 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 66 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 67 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 68 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 69 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 70 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 71 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 72 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 73 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 74 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 75 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 76 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 77 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 78 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 79 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 80 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 81 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 82 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 83 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 84 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 85 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 86 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 87 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 88 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 89 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 90 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 91 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 92 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 93 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 94 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 95 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 96 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 97 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 98 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 99 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 100 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 101 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 102 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 103 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 104 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 105 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 106 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 107 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 108 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 109 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 110 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 111 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 112 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 113 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 114 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 115 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 116 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 117 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 118 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 119 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 120 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 121 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 122 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 123 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 124 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 125 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 126 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 127 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 128 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 129 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 130 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 131 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 132 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 133 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 134 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 135 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 136 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 137 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 138 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 139 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 140 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 141 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 142 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 143 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 144 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 145 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 146 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 147 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 148 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 149 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 150 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 151 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 152 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 153 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 154 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 155 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 156 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 157 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 158 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 159 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 160 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 161 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 162 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 163 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 164 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 165 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 166 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 167 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 168 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 169 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 170 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 171 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 172 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 173 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 174 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 175 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 176 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 177 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 178 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 179 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 180 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 181 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 182 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 183 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 184 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 185 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 186 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 187 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 188 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 189 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 190 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 191 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 192 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 193 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 194 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 195 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 196 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 197 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 198 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 199 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 200 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 201 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 202 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 203 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 204 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 205 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 206 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 207 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 208 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 209 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 210 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 211 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 212 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 213 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 214 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 215 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 216 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 217 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 218 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 219 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 220 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 221 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 222 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 223 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 224 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 225 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 226 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 227 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 228 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 229 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 230 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 231 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 232 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 233 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 234 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 235 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 236 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 237 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 238 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 239 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 240 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 241 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 242 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 243 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 244 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 245 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 246 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 247 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 248 | 3300000479 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-P14 | Metagenome | Apidae |
| 249 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 250 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 251 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 252 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 253 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 254 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 255 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 256 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 257 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 258 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 259 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 260 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 261 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 262 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 263 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 264 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 265 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 266 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 267 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 268 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 269 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 270 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 271 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 272 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 273 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 274 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 275 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 276 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 277 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 278 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 279 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 280 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 281 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 282 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 283 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 284 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 285 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 286 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 287 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 288 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 289 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 290 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 291 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 292 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 293 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 294 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 295 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 296 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 297 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 298 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 299 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 300 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 301 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 302 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 303 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 304 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 305 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 306 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 307 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 308 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 309 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 310 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 311 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 312 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 313 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 314 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 315 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 316 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 317 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 318 | 3300005306 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 1 gut | Metagenome | Drosophilidae |
| 319 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 320 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 321 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 322 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562374_0027 | 3300057007 | Bacteria | 841135 |
| 2 | Ga0466713_045406 | 3300042602 | Bacteria | 136940 |
| 3 | Ga0160468_111733 | 3300012819 | Bacteria | 831 |
| 4 | Ga0160433_100393 | 3300012846 | Bacteria | 24435 |
| 5 | gam1t_NODE_578498_length=135895_GC=33_9_Contigs=9 | 2189573031 | Bacteria | 135975 |
| 6 | HBC_ctgsDRAFT_1083469 | 3300000333 | Unclassified | 754 |
| 7 | Ga0466730_078455 | 3300042625 | Bacteria | 17313 |
| 8 | Ga0466724_54760 | 3300042649 | Bacteria | 11585 |
| 9 | DPOL_contig02410 | 2035918003 | Bacteria | 23826 |
| 10 | FGTW_contig31044 | 2065487013 | Unclassified | 6367 |
| 11 | HBC_ctgsDRAFT_1028435 | 3300000333 | Bacteria | 1372 |
| 12 | HBC_ctgsDRAFT_1029004 | 3300000333 | Bacteria | 1359 |
| 13 | Meta3P_1002291 | 3300002464 | Unclassified | 7070 |
| 14 | Ga0074278_125628 | 3300005721 | Bacteria | 12003 |
| 15 | Ga0466724_20936 | 3300042649 | Bacteria | 31695 |
| 16 | Ga0265387_1000038 | 3300024582 | Bacteria | 43313 |
| 17 | Ga0316159_11706 | 3300030930 | Unclassified | 2648 |
| 18 | CVPL010L_1000116 | 3300002932 | Bacteria | 39592 |
| 19 | Ga0063521_1029208 | 3300003973 | Bacteria | 1295 |
| 20 | Ga0103267_1000345 | 3300007190 | Bacteria | 16085 |
| 21 | Ga0466730_002893 | 3300042625 | Unclassified | 12501 |
| 22 | Ga0466724_33210 | 3300042649 | Bacteria | 29971 |
| 23 | Ga0562376_0001 | 3300056857 | Bacteria | 4828905 |
| 24 | DPO_contig00251 | 2032320009 | Unclassified | 3022 |
| 25 | FGTW_contig23793 | 2065487013 | Unclassified | 3278 |
| 26 | gam1t_NODE_329229_length=5535_GC=33_7_Contigs=2 | 2189573031 | Unclassified | 5545 |
| 27 | SCG598O02_12374 | 3300000460 | Bacteria | 59134 |
| 28 | SCG598P14_11230 | 3300000479 | Unclassified | 6940 |
| 29 | Ga0063521_1000014 | 3300003973 | Bacteria | 163473 |
| 30 | Ga0074303_1075943 | 3300005306 | Bacteria | 1211 |
| 31 | Ga0074188_1000780 | 3300005318 | Bacteria | 18436 |
| 32 | Ga0074188_1155110 | 3300005318 | Unclassified | 3869 |
| 33 | Ga0074278_145440 | 3300005721 | Unclassified | 10735 |
| 34 | Ga0102736_1000793 | 3300007052 | Bacteria | 6595 |
| 35 | Ga0104051_1106338 | 3300007078 | Bacteria | 1076 |
| 36 | Ga0102734_1000479 | 3300007129 | Bacteria | 14179 |
| 37 | Ga0160433_112429 | 3300012846 | Unclassified | 1071 |
| 38 | Ga0247289_1027 | 3300035363 | Bacteria | 3028 |
| 39 | FGTW_contig31747 | 2065487013 | Unclassified | 3246 |
| 40 | 2227358542 | 2225789004 | Bacteria | 136224 |
| 41 | Ga0074306_1127757 | 3300005309 | Unclassified | 693 |
| 42 | Ga0074302_1145788 | 3300005316 | Bacteria | 904 |
| 43 | Ga0104045_1080804 | 3300007085 | Unclassified | 1170 |
| 44 | Ga0105553_1074896 | 3300007767 | Bacteria | 12073 |
| 45 | Ga0562379_0289 | 3300056790 | Bacteria | 128410 |
| 46 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 47 | Ga0160445_102149 | 3300012847 | Unclassified | 4765 |
| 48 | gam1t_NODE_693968_length=11973_GC=34_1_Contigs=4 | 2189573031 | Bacteria | 12003 |
| 49 | HBC_ctgsDRAFT_1002682 | 3300000333 | Bacteria | 4041 |
| 50 | HBC_ctgsDRAFT_1098607 | 3300000333 | Unclassified | 679 |
| 51 | SCG598J21_12823 | 3300000475 | Bacteria | 133353 |
| 52 | Ga0063521_1000039 | 3300003973 | Bacteria | 113027 |
| 53 | Ga0104051_1018459 | 3300007078 | Bacteria | 2485 |
| 54 | Ga0104050_1203957 | 3300007153 | Unclassified | 1410 |
| 55 | Ga0105005_1032581 | 3300007505 | Unclassified | 22985 |
| 56 | Ga0127645_126858 | 3300009461 | Bacteria | 9422 |
| 57 | Ga0466730_026669 | 3300042625 | Bacteria | 16828 |
| 58 | Ga0466724_62561 | 3300042649 | Bacteria | 75542 |
| 59 | Ga0160444_102659 | 3300012841 | Unclassified | 2690 |
| 60 | Ga0247289_1438 | 3300035363 | Unclassified | 2197 |
| 61 | SWWA_contig09659__length_11082___numreads_219 | 2100351016 | Unclassified | 11082 |
| 62 | HBC_ctgsDRAFT_1004617 | 3300000333 | Unclassified | 3198 |
| 63 | Ga0063521_1000030 | 3300003973 | Bacteria | 121116 |
| 64 | Ga0102735_1000005 | 3300007080 | Bacteria | 94864 |
| 65 | Ga0104042_1121399 | 3300007130 | Unclassified | 1757 |
| 66 | Ga0103268_1000100 | 3300007192 | Bacteria | 27436 |
| 67 | Ga0466730_099837 | 3300042625 | Bacteria | 28260 |
| 68 | Ga0316159_10004 | 3300030930 | Bacteria | 218282 |
| 69 | CVPL010L_1001009 | 3300002932 | Unclassified | 4653 |
| 70 | CVPL010L_1002363 | 3300002932 | Bacteria | 2408 |
| 71 | Ga0074302_1135687 | 3300005316 | Unclassified | 2956 |
| 72 | Ga0103267_1000005 | 3300007190 | Bacteria | 104420 |
| 73 | Ga0104147_1016587 | 3300007224 | Bacteria | 13617 |
| 74 | Ga0466730_099693 | 3300042625 | Bacteria | 7683 |
| 75 | Ga0466724_46825 | 3300042649 | Unclassified | 1145 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.