Protein Family IF12914
Metagenome
Isolate
390
Members
234
Samples
252
Scaffolds
112.93
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2884499693|2884500103|
- Length
- 111 aa
- Sequence
- MPNIIFYPQKFILPHGLTVQGKSGKTILDIALSNKINMEHACEKSCACCTCHCIIRKGFFSLSPCQEKEEDLLDKAWGLEKYSRLGCQARLGNEDIEVEIPLYHVNHVNEQ
Sample Types
Isolate
35.4%
Metagenome
64.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
29.4%
Termitidae
12.3%
Unclassified
11.4%
Formicidae
8.3%
Elmidae
7.0%
Kalotermitidae
6.1%
Aphididae
5.3%
Culicidae
4.4%
Curculionidae
2.2%
Armadillidiidae
1.8%
Rhinotermitidae
1.8%
Termopsidae
1.8%
Drosophilidae
1.3%
Passalidae
0.9%
Tenebrionidae
0.9%
Crambidae
0.9%
Psyllidae
0.9%
Hydrophilidae
0.9%
Pteromalidae
0.9%
Aleyrodidae
0.4%
Lysianassidae
0.4%
Hodotermitidae
0.4%
Gryllidae
0.4%
Taxonomy
Archaea
0
Bacteria
379
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 2 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 3 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 4 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 5 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 6 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 7 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 8 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 9 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 10 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 11 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 12 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 13 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 14 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 15 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 16 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 17 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 18 | 2887836388 | Buchnera aphidicola BuCisplendens/3004 | Isolate | Aphididae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 24 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 27 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 33 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 34 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 35 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 36 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 37 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 38 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 39 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 40 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 41 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 42 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 43 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 44 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 45 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 46 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 47 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 48 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 49 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 50 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 56 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 57 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 58 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 59 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 60 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 61 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 62 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 63 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 64 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 65 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 66 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 67 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 68 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 69 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 70 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 71 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 72 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 73 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 74 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 75 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 76 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 77 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 78 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 79 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 80 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 81 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 82 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 83 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 84 | 2841132873 | Buchnera aphidicola BTs Pazieg | Isolate | Aphididae |
| 85 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 86 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 87 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 88 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 89 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 90 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 91 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 92 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 93 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 94 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 95 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 96 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 97 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 98 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 99 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 100 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 101 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 102 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 103 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 104 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 105 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 106 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 107 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 108 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 109 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 110 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 111 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 112 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 113 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 114 | 2773857880 | Candidatus Profftella armatura YCPA | Isolate | Psyllidae |
| 115 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 116 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 117 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 118 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 119 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 120 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 121 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 122 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 123 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 124 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 125 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 126 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 127 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 128 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 129 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 130 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 131 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 132 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 133 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 134 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 135 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 136 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 137 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 138 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 139 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 140 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 141 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 142 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 143 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 144 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 145 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 146 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 147 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 148 | 2565956547 | Candidatus Profftella armatura | Isolate | Psyllidae |
| 149 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 150 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 151 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 152 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 153 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 154 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 155 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 156 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 157 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 158 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 159 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 160 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 161 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 162 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 163 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 164 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 165 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 166 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 167 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 168 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 169 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 170 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 171 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 172 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 173 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 174 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 175 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 176 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 177 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 178 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 179 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 180 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 181 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 182 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 183 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 184 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 185 | 2884500535 | Buchnera aphidicola BuCilaricifoliae/3058 | Isolate | Aphididae |
| 186 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 187 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 188 | 3300006995 | Ant gut microbial communities from Cephalotes angustus, Brazil | Metagenome | Formicidae |
| 189 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 190 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 191 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 192 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 193 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 194 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 195 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 196 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 197 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 198 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 199 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 200 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 201 | 643348521 | Buchnera aphidicola Cc | Isolate | Aphididae |
| 202 | 650716012 | Buchnera aphidicola Ct | Isolate | Aphididae |
| 203 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 204 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 205 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 206 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 207 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 208 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 209 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 210 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 211 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 212 | 2843639003 | Buchnera aphidicola BuCistrobi/3249 | Isolate | Aphididae |
| 213 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 214 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 215 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 216 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 217 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 218 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 219 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 220 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 221 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 222 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 223 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 224 | 2884497005 | Buchnera aphidicola BuCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 225 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 226 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 227 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 228 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 229 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 230 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 231 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 232 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 233 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 234 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_183665 | 3300042612 | Bacteria | 3227 |
| 2 | Ga0466732_008830 | 3300042656 | Bacteria | 4995 |
| 3 | Ga0466701_033276 | 3300042598 | Bacteria | 34917 |
| 4 | Ga0466701_101217 | 3300042598 | Bacteria | 4735 |
| 5 | Ga0466713_047875 | 3300042602 | Bacteria | 19469 |
| 6 | Ga0466719_037491 | 3300042606 | Bacteria | 1065 |
| 7 | Ga0466719_220409 | 3300042606 | Bacteria | 11848 |
| 8 | Ga0466719_492446 | 3300042606 | Bacteria | 10890 |
| 9 | Ga0123354_10085014 | 3300010882 | Bacteria | 4436 |
| 10 | Ga0160459_112705 | 3300012831 | Bacteria | 981 |
| 11 | Ga0466657_066479 | 3300042582 | Bacteria | 10983 |
| 12 | Ga0466657_216974 | 3300042582 | Bacteria | 1534 |
| 13 | Ga0466692_153394 | 3300042591 | Bacteria | 32696 |
| 14 | Ga0466693_295598 | 3300042592 | Bacteria | 12843 |
| 15 | HBC_ctgsDRAFT_1000061 | 3300000333 | Bacteria | 27338 |
| 16 | HBC_ctgsDRAFT_1128759 | 3300000333 | Unclassified | 567 |
| 17 | Ga0068305_10290351 | 3300005083 | Bacteria | 2620 |
| 18 | Ga0103265_1029049 | 3300007068 | Bacteria | 743 |
| 19 | Ga0102739_1009986 | 3300007095 | Bacteria | 1231 |
| 20 | Ga0102734_1000359 | 3300007129 | Bacteria | 14136 |
| 21 | Ga0102738_1012020 | 3300007141 | Unclassified | 1191 |
| 22 | Ga0102737_1008012 | 3300007142 | Bacteria | 1891 |
| 23 | Ga0103264_1006639 | 3300007188 | Bacteria | 5556 |
| 24 | Ga0103267_1000052 | 3300007190 | Bacteria | 68999 |
| 25 | Ga0466729_258353 | 3300042621 | Bacteria | 13515 |
| 26 | Ga0466703_112964 | 3300042636 | Bacteria | 58413 |
| 27 | Ga0466703_351155 | 3300042636 | Bacteria | 2027 |
| 28 | Ga0466708_048378 | 3300042652 | Bacteria | 46508 |
| 29 | Ga0466725_063326 | 3300042654 | Bacteria | 16351 |
| 30 | Ga0466725_161084 | 3300042654 | Bacteria | 30258 |
| 31 | Ga0466727_217512 | 3300042655 | Bacteria | 2839 |
| 32 | Ga0466711_247629 | 3300042615 | Bacteria | 3050 |
| 33 | Ga0466711_469852 | 3300042615 | Bacteria | 6015 |
| 34 | Ga0466718_063377 | 3300042617 | Bacteria | 1923 |
| 35 | Ga0466726_260791 | 3300042619 | Bacteria | 6070 |
| 36 | Ga0466701_026806 | 3300042598 | Bacteria | 6491 |
| 37 | Ga0466706_180744 | 3300042599 | Bacteria | 8126 |
| 38 | Ga0466717_214190 | 3300042604 | Bacteria | 11539 |
| 39 | Ga0466717_287331 | 3300042604 | Bacteria | 1705 |
| 40 | Ga0466719_132564 | 3300042606 | Bacteria | 2771 |
| 41 | Ga0466697_044096 | 3300042611 | Bacteria | 3784 |
| 42 | Ga0123357_10013022 | 3300009784 | Bacteria | 10757 |
| 43 | Ga0123356_10710393 | 3300010049 | Bacteria | 1174 |
| 44 | Ga0123356_12817302 | 3300010049 | Bacteria | 608 |
| 45 | Ga0123354_10313016 | 3300010882 | Bacteria | 1462 |
| 46 | Ga0160458_106362 | 3300012832 | Bacteria | 1383 |
| 47 | Ga0160457_1021026 | 3300012858 | Bacteria | 915 |
| 48 | Ga0466657_112233 | 3300042582 | Bacteria | 3529 |
| 49 | 2227470827 | 2225789004 | Bacteria | 926 |
| 50 | JGI24698J34947_10180045 | 3300002449 | Bacteria | 846 |
| 51 | Ga0072941_1269382 | 3300005201 | Bacteria | 9150 |
| 52 | Ga0102739_1000711 | 3300007095 | Bacteria | 6175 |
| 53 | Ga0102737_1001147 | 3300007142 | Bacteria | 7745 |
| 54 | Ga0103264_1000034 | 3300007188 | Bacteria | 107523 |
| 55 | Ga0103264_1009986 | 3300007188 | Bacteria | 4627 |
| 56 | Ga0466735_089837 | 3300042624 | Bacteria | 1993 |
| 57 | Ga0466730_041509 | 3300042625 | Unclassified | 12702 |
| 58 | Ga0466730_068023 | 3300042625 | Bacteria | 1655 |
| 59 | Ga0466709_149475 | 3300042648 | Bacteria | 22351 |
| 60 | Ga0466708_125216 | 3300042652 | Bacteria | 18877 |
| 61 | Ga0466725_085697 | 3300042654 | Bacteria | 43865 |
| 62 | Ga0466725_088820 | 3300042654 | Bacteria | 5884 |
| 63 | Ga0466725_333187 | 3300042654 | Bacteria | 3752 |
| 64 | Ga0466710_216779 | 3300042613 | Bacteria | 69189 |
| 65 | Ga0466715_060292 | 3300042616 | Bacteria | 19748 |
| 66 | Ga0466705_171973 | 3300042612 | Bacteria | 113809 |
| 67 | Ga0466733_113056 | 3300042659 | Bacteria | 90409 |
| 68 | Ga0466733_159921 | 3300042659 | Bacteria | 3831 |
| 69 | Ga0466707_135767 | 3300042601 | Bacteria | 1098 |
| 70 | Ga0466719_071846 | 3300042606 | Bacteria | 3353 |
| 71 | Ga0466719_436472 | 3300042606 | Bacteria | 1184 |
| 72 | Ga0123354_10000002 | 3300010882 | Bacteria | 317342 |
| 73 | Ga0160446_100617 | 3300012835 | Bacteria | 13026 |
| 74 | Ga0160434_126023 | 3300012850 | Bacteria | 856 |
| 75 | Ga0316159_12095 | 3300030930 | Bacteria | 5550 |
| 76 | Ga0466657_012444 | 3300042582 | Bacteria | 321104 |
| 77 | Ga0466690_094861 | 3300042590 | Bacteria | 20373 |
| 78 | Ga0466691_130952 | 3300042593 | Bacteria | 13955 |
| 79 | Ga0466691_186635 | 3300042593 | Bacteria | 1457 |
| 80 | JGI24702J35022_10140130 | 3300002462 | Bacteria | 1349 |
| 81 | CVPL005W_1000215 | 3300002934 | Bacteria | 61328 |
| 82 | Ga0103265_1034030 | 3300007068 | Bacteria | 692 |
| 83 | Ga0102735_1000025 | 3300007080 | Bacteria | 93479 |
| 84 | Ga0102738_1018940 | 3300007141 | Bacteria | 978 |
| 85 | Ga0103264_1002939 | 3300007188 | Bacteria | 7772 |
| 86 | Ga0466730_030029 | 3300042625 | Bacteria | 423027 |
| 87 | Ga0466702_462639 | 3300042635 | Bacteria | 3459 |
| 88 | Ga0466709_010553 | 3300042648 | Bacteria | 13046 |
| 89 | Ga0466724_29583 | 3300042649 | Bacteria | 6591 |
| 90 | Ga0466725_036336 | 3300042654 | Bacteria | 2998 |
| 91 | Ga0466725_069031 | 3300042654 | Bacteria | 10014 |
| 92 | Ga0466710_066373 | 3300042613 | Bacteria | 2362 |
| 93 | Ga0466712_154653 | 3300042614 | Bacteria | 4277 |
| 94 | Ga0466723_025480 | 3300042618 | Bacteria | 19975 |
| 95 | Ga0466728_111558 | 3300042620 | Bacteria | 5664 |
| 96 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 97 | Ga0466706_212489 | 3300042599 | Bacteria | 5929 |
| 98 | Ga0466713_011402 | 3300042602 | Bacteria | 1701 |
| 99 | Ga0466717_220486 | 3300042604 | Bacteria | 2541 |
| 100 | Ga0466716_060221 | 3300042605 | Bacteria | 1465 |
| 101 | Ga0466719_132595 | 3300042606 | Bacteria | 2460 |
| 102 | Ga0466721_017051 | 3300042608 | Bacteria | 1616 |
| 103 | Ga0466722_189922 | 3300042609 | Bacteria | 1943 |
| 104 | Ga0160441_102996 | 3300012825 | Bacteria | 3050 |
| 105 | Ga0160455_126173 | 3300012837 | Bacteria | 502 |
| 106 | Ga0160447_105391 | 3300012849 | Bacteria | 3572 |
| 107 | Ga0160436_1035710 | 3300012861 | Unclassified | 817 |
| 108 | Ga0466656_339002 | 3300042550 | Bacteria | 2788 |
| 109 | Ga0466657_250699 | 3300042582 | Bacteria | 30954 |
| 110 | Ga0466692_029401 | 3300042591 | Bacteria | 33046 |
| 111 | Ga0466696_252299 | 3300042596 | Bacteria | 2673 |
| 112 | Ga0466696_467890 | 3300042596 | Bacteria | 1422 |
| 113 | CVPL010W_10004627 | 3300002931 | Bacteria | 15154 |
| 114 | Ga0068302_10035708 | 3300005071 | Bacteria | 5316 |
| 115 | Ga0102733_106628 | 3300006995 | Unclassified | 734 |
| 116 | Ga0102736_1000546 | 3300007052 | Bacteria | 7972 |
| 117 | Ga0103266_1000261 | 3300007067 | Bacteria | 13326 |
| 118 | Ga0103261_1004728 | 3300007083 | Unclassified | 2559 |
| 119 | Ga0102734_1026847 | 3300007129 | Bacteria | 1467 |
| 120 | Ga0103260_1001202 | 3300007139 | Bacteria | 4705 |
| 121 | Ga0102740_1023041 | 3300007140 | Bacteria | 955 |
| 122 | Ga0102738_1000137 | 3300007141 | Bacteria | 20906 |
| 123 | Ga0104040_1186805 | 3300007149 | Bacteria | 560 |
| 124 | Ga0466734_034769 | 3300042623 | Bacteria | 9797 |
| 125 | Ga0466734_064208 | 3300042623 | Bacteria | 5133 |
| 126 | Ga0466734_088888 | 3300042623 | Bacteria | 18155 |
| 127 | Ga0466734_127240 | 3300042623 | Bacteria | 1679 |
| 128 | Ga0466735_121233 | 3300042624 | Bacteria | 1326 |
| 129 | Ga0466730_088042 | 3300042625 | Bacteria | 113057 |
| 130 | Ga0466704_043595 | 3300042643 | Bacteria | 28096 |
| 131 | Ga0466709_342844 | 3300042648 | Bacteria | 1807 |
| 132 | Ga0466724_30293 | 3300042649 | Bacteria | 20030 |
| 133 | Ga0466725_129448 | 3300042654 | Bacteria | 92830 |
| 134 | Ga0466729_176159 | 3300042621 | Bacteria | 1150 |
| 135 | Ga0466705_264938 | 3300042612 | Bacteria | 25031 |
| 136 | Ga0466701_031304 | 3300042598 | Bacteria | 23728 |
| 137 | Ga0466701_098117 | 3300042598 | Bacteria | 1546 |
| 138 | Ga0466697_040478 | 3300042611 | Bacteria | 5629 |
| 139 | Ga0123356_10272643 | 3300010049 | Bacteria | 1783 |
| 140 | Ga0123354_10001096 | 3300010882 | Bacteria | 31351 |
| 141 | Ga0160470_102484 | 3300012813 | Bacteria | 3456 |
| 142 | Ga0160472_105807 | 3300012839 | Bacteria | 1926 |
| 143 | Ga0466656_037320 | 3300042550 | Bacteria | 1091 |
| 144 | Ga0466657_028278 | 3300042582 | Unclassified | 1434 |
| 145 | Ga0466690_026266 | 3300042590 | Bacteria | 36904 |
| 146 | Ga0466694_183563 | 3300042594 | Bacteria | 4552 |
| 147 | Ga0466699_069825 | 3300042597 | Bacteria | 2143 |
| 148 | IMNBGM34_c052833 | 3300000036 | Bacteria | 536 |
| 149 | HBC_ctgsDRAFT_1043547 | 3300000333 | Bacteria | 1097 |
| 150 | JGI24702J35022_10002074 | 3300002462 | Bacteria | 12355 |
| 151 | CVPL010W_10004150 | 3300002931 | Bacteria | 26009 |
| 152 | Ga0072941_1136990 | 3300005201 | Bacteria | 2588 |
| 153 | Ga0102737_1003329 | 3300007142 | Unclassified | 3704 |
| 154 | Ga0105005_1009177 | 3300007505 | Bacteria | 2802 |
| 155 | Ga0466729_206085 | 3300042621 | Bacteria | 8491 |
| 156 | Ga0466735_072118 | 3300042624 | Bacteria | 2207 |
| 157 | Ga0466724_12487 | 3300042649 | Bacteria | 2189 |
| 158 | Ga0466724_69469 | 3300042649 | Bacteria | 29864 |
| 159 | Ga0466708_242651 | 3300042652 | Bacteria | 23851 |
| 160 | Ga0466708_416889 | 3300042652 | Bacteria | 4080 |
| 161 | Ga0466725_163593 | 3300042654 | Bacteria | 5092 |
| 162 | Ga0466710_039634 | 3300042613 | Bacteria | 1234 |
| 163 | Ga0466710_312404 | 3300042613 | Bacteria | 1116 |
| 164 | Ga0466728_260408 | 3300042620 | Bacteria | 3957 |
| 165 | Ga0466716_126676 | 3300042605 | Bacteria | 2424 |
| 166 | Ga0466719_349400 | 3300042606 | Bacteria | 1100 |
| 167 | Ga0123354_10056960 | 3300010882 | Bacteria | 5828 |
| 168 | Ga0160470_118968 | 3300012813 | Bacteria | 530 |
| 169 | Ga0160431_100004 | 3300012828 | Bacteria | 341144 |
| 170 | Ga0160467_100306 | 3300012829 | Bacteria | 56222 |
| 171 | Ga0160435_1031358 | 3300012857 | Unclassified | 832 |
| 172 | Ga0466657_056541 | 3300042582 | Bacteria | 144917 |
| 173 | Ga0466690_208290 | 3300042590 | Bacteria | 1358 |
| 174 | Ga0466695_310380 | 3300042595 | Bacteria | 5956 |
| 175 | CVPL010W_10004425 | 3300002931 | Unclassified | 17430 |
| 176 | CVPL010W_10014486 | 3300002931 | Bacteria | 6867 |
| 177 | Ga0102735_1013002 | 3300007080 | Bacteria | 1069 |
| 178 | Ga0102739_1000981 | 3300007095 | Bacteria | 4991 |
| 179 | Ga0102734_1017194 | 3300007129 | Bacteria | 1767 |
| 180 | Ga0103260_1003959 | 3300007139 | Bacteria | 2307 |
| 181 | Ga0104048_1007028 | 3300007143 | Bacteria | 1029 |
| 182 | Ga0103267_1037692 | 3300007190 | Bacteria | 1611 |
| 183 | Ga0103268_1000739 | 3300007192 | Bacteria | 9278 |
| 184 | Ga0103268_1009255 | 3300007192 | Bacteria | 2040 |
| 185 | Ga0466734_046476 | 3300042623 | Bacteria | 5741 |
| 186 | Ga0466734_051963 | 3300042623 | Bacteria | 4075 |
| 187 | Ga0466734_064326 | 3300042623 | Bacteria | 27618 |
| 188 | Ga0466735_087442 | 3300042624 | Bacteria | 3859 |
| 189 | Ga0466703_416819 | 3300042636 | Bacteria | 2720 |
| 190 | Ga0466725_197826 | 3300042654 | Bacteria | 3455 |
| 191 | Ga0466711_271943 | 3300042615 | Bacteria | 42179 |
| 192 | Ga0466715_305867 | 3300042616 | Bacteria | 2129 |
| 193 | Ga0466723_320043 | 3300042618 | Bacteria | 1219 |
| 194 | Ga0466726_163499 | 3300042619 | Bacteria | 5816 |
| 195 | Ga0466697_063126 | 3300042611 | Bacteria | 3261 |
| 196 | Ga0466701_026944 | 3300042598 | Bacteria | 1347 |
| 197 | Ga0466707_099821 | 3300042601 | Bacteria | 13848 |
| 198 | Ga0466707_128695 | 3300042601 | Bacteria | 21572 |
| 199 | Ga0466707_161587 | 3300042601 | Bacteria | 32712 |
| 200 | Ga0466713_094229 | 3300042602 | Bacteria | 1025 |
| 201 | Ga0466719_174623 | 3300042606 | Bacteria | 2500 |
| 202 | Ga0123353_10174930 | 3300010167 | Bacteria | 3404 |
| 203 | Ga0123353_12544518 | 3300010167 | Bacteria | 607 |
| 204 | Ga0123354_10578926 | 3300010882 | Bacteria | 833 |
| 205 | Ga0160445_100048 | 3300012847 | Bacteria | 142304 |
| 206 | Ga0466693_101401 | 3300042592 | Bacteria | 1630 |
| 207 | Ga0466696_312368 | 3300042596 | Bacteria | 1286 |
| 208 | JGI24705J35276_12216979 | 3300002504 | Bacteria | 2070 |
| 209 | CVPL010W_10009583 | 3300002931 | Bacteria | 14780 |
| 210 | Ga0063521_1018967 | 3300003973 | Bacteria | 1662 |
| 211 | Ga0103266_1019743 | 3300007067 | Bacteria | 822 |
| 212 | Ga0103265_1010067 | 3300007068 | Unclassified | 1236 |
| 213 | Ga0102740_1000015 | 3300007140 | Bacteria | 46459 |
| 214 | Ga0103264_1000245 | 3300007188 | Bacteria | 30824 |
| 215 | Ga0103268_1000518 | 3300007192 | Bacteria | 11577 |
| 216 | Ga0466730_036339 | 3300042625 | Bacteria | 1267 |
| 217 | Ga0466703_050912 | 3300042636 | Bacteria | 3333 |
| 218 | Ga0466703_425473 | 3300042636 | Bacteria | 16451 |
| 219 | Ga0466709_304835 | 3300042648 | Bacteria | 2979 |
| 220 | Ga0466724_30833 | 3300042649 | Bacteria | 1066 |
| 221 | Ga0466708_201539 | 3300042652 | Bacteria | 12476 |
| 222 | Ga0466725_232841 | 3300042654 | Bacteria | 20285 |
| 223 | Ga0466710_051880 | 3300042613 | Bacteria | 13149 |
| 224 | Ga0466715_094269 | 3300042616 | Bacteria | 25306 |
| 225 | Ga0466697_074043 | 3300042611 | Bacteria | 1461 |
| 226 | Ga0466701_034847 | 3300042598 | Bacteria | 1837 |
| 227 | Ga0466701_045301 | 3300042598 | Bacteria | 173556 |
| 228 | Ga0466719_553922 | 3300042606 | Bacteria | 1415 |
| 229 | Ga0466722_124537 | 3300042609 | Bacteria | 7692 |
| 230 | Ga0123357_10097125 | 3300009784 | Bacteria | 3813 |
| 231 | Ga0123357_10108931 | 3300009784 | Bacteria | 3540 |
| 232 | Ga0160464_100109 | 3300012805 | Bacteria | 93596 |
| 233 | Ga0160471_111582 | 3300012812 | Bacteria | 940 |
| 234 | Ga0160470_101470 | 3300012813 | Bacteria | 5618 |
| 235 | Ga0466656_248710 | 3300042550 | Bacteria | 1121 |
| 236 | Ga0466657_107320 | 3300042582 | Bacteria | 2522 |
| 237 | Ga0466693_121806 | 3300042592 | Bacteria | 1770 |
| 238 | Ga0466701_007329 | 3300042598 | Bacteria | 2923 |
| 239 | JGI24695J34938_10031047 | 3300002450 | Bacteria | 2483 |
| 240 | Ga0072941_1008779 | 3300005201 | Bacteria | 10347 |
| 241 | Ga0103266_1000095 | 3300007067 | Bacteria | 70151 |
| 242 | Ga0102735_1000038 | 3300007080 | Bacteria | 33598 |
| 243 | Ga0103261_1005180 | 3300007083 | Bacteria | 1934 |
| 244 | Ga0102734_1092241 | 3300007129 | Bacteria | 751 |
| 245 | Ga0466734_113597 | 3300042623 | Bacteria | 5691 |
| 246 | Ga0466734_147729 | 3300042623 | Bacteria | 5277 |
| 247 | Ga0466704_147936 | 3300042643 | Bacteria | 3705 |
| 248 | Ga0466724_07603 | 3300042649 | Bacteria | 364013 |
| 249 | Ga0466708_114657 | 3300042652 | Bacteria | 19666 |
| 250 | Ga0466725_031050 | 3300042654 | Bacteria | 1880 |
| 251 | Ga0466715_385731 | 3300042616 | Bacteria | 3605 |
| 252 | Ga0466723_371352 | 3300042618 | Bacteria | 4840 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.