Protein Family IF11830
Metagenome
Isolate
214
Members
63
Samples
208
Scaffolds
150.53
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125687|2781420511|
- Length
- 170 aa
- Sequence
- MKVIVFIIFWILLARLLKLDNAITKKILFEMEQIDQLINDSSPLLNLCNVREPDFVERCGIALILQSFYNGIENIVVLIMKNKGIILSDGTKWHKDLLSKTFEGNENEYQMFREELKAPLNDYLQFRHFVRHTYGFQLKWGKMKNLFFDMNIIWGKIKEDLNKFLNGKSP
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.1%
Kalotermitidae
23.0%
Unclassified
11.5%
Rhinotermitidae
4.9%
Termopsidae
4.9%
Hodotermitidae
1.6%
Taxonomy
Archaea
1
Bacteria
203
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 13 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 20 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 38 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 39 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 40 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 46 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 47 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 48 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 49 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 56 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 57 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 58 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 59 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 60 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 61 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 62 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 63 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_223477 | 3300042612 | Bacteria | 17532 |
| 2 | Ga0466705_363789 | 3300042612 | Archaea | 3906 |
| 3 | Ga0466733_014241 | 3300042659 | Bacteria | 4053 |
| 4 | Ga0123356_10031278 | 3300010049 | Bacteria | 4981 |
| 5 | Ga0466705_428010 | 3300042612 | Bacteria | 1087 |
| 6 | Ga0466712_040915 | 3300042614 | Bacteria | 2752 |
| 7 | Ga0466712_191479 | 3300042614 | Bacteria | 2373 |
| 8 | Ga0466718_004027 | 3300042617 | Bacteria | 1641 |
| 9 | Ga0466728_299057 | 3300042620 | Bacteria | 1181 |
| 10 | Ga0466702_262439 | 3300042635 | Bacteria | 1445 |
| 11 | Ga0466702_379432 | 3300042635 | Bacteria | 1807 |
| 12 | Ga0466703_162391 | 3300042636 | Bacteria | 1308 |
| 13 | Ga0466704_450823 | 3300042643 | Bacteria | 2444 |
| 14 | Ga0466708_160025 | 3300042652 | Bacteria | 1266 |
| 15 | Ga0466708_362710 | 3300042652 | Bacteria | 1094 |
| 16 | Ga0466701_095731 | 3300042598 | Bacteria | 1177 |
| 17 | Ga0466706_136686 | 3300042599 | Bacteria | 1223 |
| 18 | Ga0466716_323901 | 3300042605 | Bacteria | 1359 |
| 19 | Ga0466719_314946 | 3300042606 | Bacteria | 1135 |
| 20 | Ga0466721_327903 | 3300042608 | Bacteria | 1181 |
| 21 | Ga0466722_112204 | 3300042609 | Bacteria | 1971 |
| 22 | JGI24698J34947_10000063 | 3300002449 | Bacteria | 33343 |
| 23 | JGI24698J34947_10017947 | 3300002449 | Bacteria | 3830 |
| 24 | Ga0466690_280933 | 3300042590 | Bacteria | 1235 |
| 25 | Ga0466694_088498 | 3300042594 | Bacteria | 2539 |
| 26 | Ga0466694_134104 | 3300042594 | Bacteria | 1012 |
| 27 | Ga0466696_251570 | 3300042596 | Bacteria | 1767 |
| 28 | Ga0123355_10065326 | 3300009826 | Bacteria | 5860 |
| 29 | Ga0123356_10509245 | 3300010049 | Bacteria | 1361 |
| 30 | Ga0123356_10725869 | 3300010049 | Bacteria | 1163 |
| 31 | Ga0466705_413540 | 3300042612 | Unclassified | 4232 |
| 32 | Ga0466712_013430 | 3300042614 | Bacteria | 12564 |
| 33 | Ga0466712_134438 | 3300042614 | Bacteria | 2734 |
| 34 | Ga0466711_083561 | 3300042615 | Bacteria | 3207 |
| 35 | Ga0466728_166145 | 3300042620 | Bacteria | 2056 |
| 36 | Ga0466731_113984 | 3300042622 | Bacteria | 2730 |
| 37 | Ga0466704_317066 | 3300042643 | Bacteria | 1325 |
| 38 | Ga0466709_336207 | 3300042648 | Bacteria | 2537 |
| 39 | Ga0466727_125378 | 3300042655 | Bacteria | 7325 |
| 40 | Ga0466707_356097 | 3300042601 | Bacteria | 1291 |
| 41 | Ga0466719_176651 | 3300042606 | Bacteria | 1961 |
| 42 | Ga0466721_052794 | 3300042608 | Bacteria | 1333 |
| 43 | Ga0466698_193884 | 3300042610 | Bacteria | 1103 |
| 44 | AustNasuHG_c1034553 | 3300000089 | Bacteria | 1351 |
| 45 | JGI24698J34947_10065535 | 3300002449 | Unclassified | 1771 |
| 46 | JGI24696J40584_12847462 | 3300002834 | Bacteria | 971 |
| 47 | Ga0466691_016356 | 3300042593 | Bacteria | 2597 |
| 48 | Ga0466691_179503 | 3300042593 | Bacteria | 8017 |
| 49 | Ga0466695_243244 | 3300042595 | Bacteria | 1064 |
| 50 | Ga0466699_175106 | 3300042597 | Bacteria | 2197 |
| 51 | Ga0466699_247948 | 3300042597 | Bacteria | 1981 |
| 52 | Ga0466705_101330 | 3300042612 | Bacteria | 1893 |
| 53 | Ga0466705_193600 | 3300042612 | Bacteria | 1747 |
| 54 | Ga0466732_044983 | 3300042656 | Unclassified | 1019 |
| 55 | Ga0466732_063648 | 3300042656 | Bacteria | 1809 |
| 56 | Ga0466733_096849 | 3300042659 | Bacteria | 1317 |
| 57 | Ga0123355_10171569 | 3300009826 | Bacteria | 3241 |
| 58 | Ga0466711_398683 | 3300042615 | Bacteria | 1105 |
| 59 | Ga0466729_293501 | 3300042621 | Bacteria | 2665 |
| 60 | Ga0466734_163135 | 3300042623 | Bacteria | 1047 |
| 61 | Ga0466704_220960 | 3300042643 | Bacteria | 1686 |
| 62 | Ga0466724_15938 | 3300042649 | Bacteria | 2072 |
| 63 | Ga0466727_202453 | 3300042655 | Bacteria | 2072 |
| 64 | Ga0466727_335948 | 3300042655 | Bacteria | 3321 |
| 65 | Ga0466706_213418 | 3300042599 | Bacteria | 1054 |
| 66 | Ga0466707_401167 | 3300042601 | Bacteria | 1187 |
| 67 | Ga0466720_074835 | 3300042607 | Bacteria | 1124 |
| 68 | Ga0466720_097047 | 3300042607 | Bacteria | 1104 |
| 69 | Ga0466722_105825 | 3300042609 | Bacteria | 4495 |
| 70 | JGI24698J34947_10034886 | 3300002449 | Bacteria | 2629 |
| 71 | JGI24698J34947_10096245 | 3300002449 | Bacteria | 1343 |
| 72 | JGI24698J34947_10120211 | 3300002449 | Bacteria | 1141 |
| 73 | JGI24698J34947_10192788 | 3300002449 | Unclassified | 805 |
| 74 | JGI24698J34947_10293225 | 3300002449 | Unclassified | 589 |
| 75 | Ga0466657_192472 | 3300042582 | Bacteria | 1155 |
| 76 | Ga0466690_330910 | 3300042590 | Bacteria | 8873 |
| 77 | Ga0466695_043199 | 3300042595 | Bacteria | 1217 |
| 78 | Ga0466705_040355 | 3300042612 | Bacteria | 26196 |
| 79 | Ga0466732_187863 | 3300042656 | Bacteria | 6315 |
| 80 | Ga0466732_310688 | 3300042656 | Bacteria | 10531 |
| 81 | Ga0123353_10181958 | 3300010167 | Bacteria | 3326 |
| 82 | Ga0466712_256218 | 3300042614 | Bacteria | 1367 |
| 83 | Ga0466711_444940 | 3300042615 | Bacteria | 15784 |
| 84 | Ga0466715_134335 | 3300042616 | Bacteria | 1708 |
| 85 | Ga0466718_048280 | 3300042617 | Bacteria | 1030 |
| 86 | Ga0466718_086068 | 3300042617 | Bacteria | 1310 |
| 87 | Ga0466723_019475 | 3300042618 | Bacteria | 3461 |
| 88 | Ga0466723_134318 | 3300042618 | Bacteria | 1248 |
| 89 | Ga0466728_239086 | 3300042620 | Bacteria | 1649 |
| 90 | Ga0466702_104693 | 3300042635 | Bacteria | 1153 |
| 91 | Ga0466704_083808 | 3300042643 | Bacteria | 2403 |
| 92 | Ga0466704_291206 | 3300042643 | Bacteria | 5471 |
| 93 | AustNasuHG_c1004000 | 3300000089 | Bacteria | 5305 |
| 94 | JGI24698J34947_10004479 | 3300002449 | Bacteria | 7607 |
| 95 | JGI24698J34947_10023295 | 3300002449 | Bacteria | 3313 |
| 96 | JGI24698J34947_10144295 | 3300002449 | Bacteria | 998 |
| 97 | Ga0466733_081226 | 3300042659 | Bacteria | 2704 |
| 98 | Ga0123357_10461722 | 3300009784 | Bacteria | 1091 |
| 99 | Ga0123356_10012541 | 3300010049 | Bacteria | 8218 |
| 100 | Ga0123356_10098416 | 3300010049 | Bacteria | 2801 |
| 101 | Ga0123356_10122362 | 3300010049 | Unclassified | 2534 |
| 102 | Ga0123356_11407743 | 3300010049 | Bacteria | 857 |
| 103 | Ga0123353_12225673 | 3300010167 | Bacteria | 662 |
| 104 | Ga0466712_068659 | 3300042614 | Bacteria | 15970 |
| 105 | Ga0466712_077906 | 3300042614 | Bacteria | 3200 |
| 106 | Ga0466712_240664 | 3300042614 | Bacteria | 1302 |
| 107 | Ga0466712_307523 | 3300042614 | Bacteria | 8537 |
| 108 | Ga0466718_068909 | 3300042617 | Bacteria | 9706 |
| 109 | Ga0466726_454512 | 3300042619 | Bacteria | 3958 |
| 110 | Ga0466728_232400 | 3300042620 | Bacteria | 6693 |
| 111 | Ga0466703_071104 | 3300042636 | Bacteria | 4128 |
| 112 | Ga0466704_089593 | 3300042643 | Bacteria | 3762 |
| 113 | Ga0466704_322121 | 3300042643 | Bacteria | 10700 |
| 114 | Ga0466704_366372 | 3300042643 | Bacteria | 6412 |
| 115 | Ga0466709_326808 | 3300042648 | Bacteria | 1321 |
| 116 | Ga0466708_034520 | 3300042652 | Bacteria | 1001 |
| 117 | Ga0466717_289334 | 3300042604 | Bacteria | 4292 |
| 118 | Ga0466719_008609 | 3300042606 | Bacteria | 2778 |
| 119 | Ga0466719_359600 | 3300042606 | Bacteria | 2206 |
| 120 | AustNasuHG_c1031948 | 3300000089 | Bacteria | 1473 |
| 121 | FAAS_10267415 | 3300001880 | Bacteria | 512 |
| 122 | JGI24698J34947_10019745 | 3300002449 | Bacteria | 3632 |
| 123 | JGI24698J34947_10027520 | 3300002449 | Bacteria | 3016 |
| 124 | Ga0072940_1045227 | 3300005200 | Bacteria | 1034 |
| 125 | Ga0466694_091434 | 3300042594 | Bacteria | 1183 |
| 126 | Ga0466694_198946 | 3300042594 | Bacteria | 14685 |
| 127 | Ga0466694_227051 | 3300042594 | Bacteria | 2187 |
| 128 | Ga0466705_347102 | 3300042612 | Bacteria | 1817 |
| 129 | Ga0466732_321011 | 3300042656 | Bacteria | 1317 |
| 130 | Ga0466733_046107 | 3300042659 | Bacteria | 1016 |
| 131 | Ga0123356_10211681 | 3300010049 | Bacteria | 1988 |
| 132 | Ga0123353_11564385 | 3300010167 | Bacteria | 835 |
| 133 | Ga0466712_296131 | 3300042614 | Bacteria | 2523 |
| 134 | Ga0466711_142810 | 3300042615 | Bacteria | 1295 |
| 135 | Ga0466726_028924 | 3300042619 | Bacteria | 2097 |
| 136 | Ga0466731_163395 | 3300042622 | Bacteria | 1887 |
| 137 | Ga0466731_367980 | 3300042622 | Bacteria | 5289 |
| 138 | Ga0466702_171886 | 3300042635 | Bacteria | 2531 |
| 139 | Ga0466709_351589 | 3300042648 | Bacteria | 1170 |
| 140 | Ga0466700_477060 | 3300042600 | Bacteria | 1406 |
| 141 | Ga0466720_055641 | 3300042607 | Bacteria | 5519 |
| 142 | JGI24698J34947_10070842 | 3300002449 | Bacteria | 1676 |
| 143 | JGI24698J34947_10317743 | 3300002449 | Unclassified | 555 |
| 144 | Ga0264413_142071 | 3300024493 | Bacteria | 1595 |
| 145 | Ga0466696_071110 | 3300042596 | Bacteria | 1115 |
| 146 | Ga0466696_179518 | 3300042596 | Bacteria | 1753 |
| 147 | Ga0466705_009414 | 3300042612 | Bacteria | 4547 |
| 148 | Ga0466705_183230 | 3300042612 | Bacteria | 2997 |
| 149 | Ga0466733_019020 | 3300042659 | Bacteria | 5238 |
| 150 | Ga0123356_10000505 | 3300010049 | Bacteria | 43649 |
| 151 | Ga0123356_11302124 | 3300010049 | Bacteria | 890 |
| 152 | Ga0123353_10921046 | 3300010167 | Bacteria | 1187 |
| 153 | Ga0466729_065484 | 3300042621 | Bacteria | 2328 |
| 154 | Ga0466735_193781 | 3300042624 | Bacteria | 1058 |
| 155 | Ga0466702_462006 | 3300042635 | Bacteria | 1670 |
| 156 | Ga0466704_563100 | 3300042643 | Bacteria | 1736 |
| 157 | Ga0466727_331133 | 3300042655 | Bacteria | 1518 |
| 158 | Ga0466701_095066 | 3300042598 | Bacteria | 3269 |
| 159 | Ga0466716_381512 | 3300042605 | Bacteria | 1093 |
| 160 | Ga0466719_105837 | 3300042606 | Bacteria | 1050 |
| 161 | Ga0466719_261350 | 3300042606 | Bacteria | 1274 |
| 162 | Ga0466719_279440 | 3300042606 | Bacteria | 17066 |
| 163 | AustNasuHG_c1022694 | 3300000089 | Bacteria | 2013 |
| 164 | AustNasuHG_c1047764 | 3300000089 | Bacteria | 950 |
| 165 | JGI24698J34947_10024664 | 3300002449 | Bacteria | 3210 |
| 166 | JGI24698J34947_10038600 | 3300002449 | Bacteria | 2476 |
| 167 | JGI24695J34938_10122867 | 3300002450 | Bacteria | 1057 |
| 168 | JGI24695J34938_10582037 | 3300002450 | Bacteria | 520 |
| 169 | JGI24702J35022_10850880 | 3300002462 | Bacteria | 568 |
| 170 | JGI24705J35276_11878040 | 3300002504 | Bacteria | 734 |
| 171 | JGI24696J40584_12624527 | 3300002834 | Unclassified | 674 |
| 172 | JGI24696J40584_12953755 | 3300002834 | Bacteria | 2530 |
| 173 | JGI24696J40584_12955244 | 3300002834 | Unclassified | 2793 |
| 174 | Ga0264413_136415 | 3300024493 | Bacteria | 1561 |
| 175 | Ga0456237_0022496 | 3300041968 | Bacteria | 866 |
| 176 | Ga0466656_241966 | 3300042550 | Bacteria | 1512 |
| 177 | Ga0466690_217694 | 3300042590 | Bacteria | 1311 |
| 178 | Ga0466691_040466 | 3300042593 | Bacteria | 8214 |
| 179 | Ga0466696_500810 | 3300042596 | Bacteria | 2618 |
| 180 | Ga0466699_393806 | 3300042597 | Bacteria | 1518 |
| 181 | Ga0466705_237127 | 3300042612 | Bacteria | 1489 |
| 182 | Ga0466732_225393 | 3300042656 | Bacteria | 3122 |
| 183 | Ga0466732_401143 | 3300042656 | Bacteria | 2684 |
| 184 | Ga0466733_068272 | 3300042659 | Bacteria | 11849 |
| 185 | Ga0123356_10151137 | 3300010049 | Bacteria | 2305 |
| 186 | Ga0466712_122612 | 3300042614 | Bacteria | 1231 |
| 187 | Ga0466712_265305 | 3300042614 | Bacteria | 8092 |
| 188 | Ga0466728_174359 | 3300042620 | Bacteria | 6330 |
| 189 | Ga0466703_414975 | 3300042636 | Bacteria | 9788 |
| 190 | Ga0466704_027790 | 3300042643 | Bacteria | 3865 |
| 191 | Ga0466704_111836 | 3300042643 | Bacteria | 3204 |
| 192 | Ga0466717_027610 | 3300042604 | Bacteria | 1399 |
| 193 | Ga0466720_103230 | 3300042607 | Bacteria | 5340 |
| 194 | Ga0466720_150669 | 3300042607 | Bacteria | 89971 |
| 195 | Ga0466721_397095 | 3300042608 | Bacteria | 1350 |
| 196 | JGI24698J34947_10056246 | 3300002449 | Bacteria | 1957 |
| 197 | JGI24698J34947_10245704 | 3300002449 | Bacteria | 671 |
| 198 | JGI24702J35022_10005984 | 3300002462 | Bacteria | 7065 |
| 199 | JGI24697J35500_11111771 | 3300002507 | Bacteria | 1200 |
| 200 | Ga0072940_1003501 | 3300005200 | Bacteria | 6886 |
| 201 | Ga0074263_134527 | 3300005485 | Bacteria | 889 |
| 202 | Ga0264413_123129 | 3300024493 | Unclassified | 3603 |
| 203 | Ga0415639_162705 | 3300038395 | Bacteria | 1514 |
| 204 | Ga0456237_0004015 | 3300041968 | Bacteria | 2368 |
| 205 | Ga0466690_307181 | 3300042590 | Bacteria | 1263 |
| 206 | Ga0466694_023028 | 3300042594 | Bacteria | 61948 |
| 207 | Ga0466695_212494 | 3300042595 | Bacteria | 1524 |
| 208 | Ga0466696_035760 | 3300042596 | Bacteria | 1468 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF20797 | HepT-like_2 | HepT-like protein | 61 | 165 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.