Protein Family IF10428
Metagenome
Isolate
295
Members
202
Samples
154
Scaffolds
324.9
Avg Length
Representative Sequence
- ID
- 3300056790|Ga0562379_0258|Ga0562379_0258_69482_70591
- Length
- 369 aa
- Sequence
- MTEKQTINKLQRTLTKRFLTLTSNFAFSDCVVLLTRMPKKGAVTYLTEERISLEIQLTQNDDISLLLGSHDKHIKVIEDATQTTIHTRGEMIQITGEKVAAEKAQSVIHALQELIKRGINISTPDVITALNMANKGNLDYFTDMYEEEIIKDRNGKPIRAKNAGQKKYIEAIRTHDVVFGVGPAGTGKTFLAVVMAIAALKKGQVQKIILTRPAVEAGENLGFLPGDLKEKVDPYLRPVYDALYQIFGMDHTNRLMERGVIEIAPLAYMRGRTLEDAFVILDEAQNTTIAQMKMFLTRLGFNSKMIVNGDTSQIDLPKGTTSGLVHAQRALEAIPKIAFAHFEAGDVVRHPVVADIIRAYEESDSKEKR
Sample Types
Isolate
47.8%
Metagenome
52.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
29.4%
Termitidae
15.5%
Apidae
14.4%
Drosophilidae
11.8%
Halictidae
4.3%
Tenebrionidae
4.3%
Kalotermitidae
3.7%
Scarabaeidae
3.2%
Rhinotermitidae
1.6%
Termopsidae
1.6%
Passalidae
1.1%
Blattidae
1.1%
Dytiscidae
1.1%
Formicidae
1.1%
Libellulidae
0.5%
Hydrophilidae
0.5%
Cerambycidae
0.5%
Elmidae
0.5%
Curculionidae
0.5%
Calliphoridae
0.5%
Vespidae
0.5%
Bombycidae
0.5%
Hodotermitidae
0.5%
Gomphidae
0.5%
Noctuidae
0.5%
Taxonomy
Archaea
0
Bacteria
284
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 2 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 3 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 4 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 5 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 6 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 7 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 8 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 9 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 10 | 2820411483 | Unclassified Firmicutes Lab288P4bin76 | Isolate | Unclassified |
| 11 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 12 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 13 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 14 | 2820176377 | Unclassified Planctomycetes Th196P3bin111 | Isolate | Unclassified |
| 15 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 16 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 17 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 18 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 23 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 24 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 25 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 26 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 27 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 28 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 29 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 30 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 31 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 32 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 33 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 34 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 35 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 36 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 37 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 40 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 41 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 42 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 43 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 44 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 45 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 46 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 47 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 48 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 49 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 50 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 51 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 52 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 53 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 54 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 55 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 56 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 57 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 58 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 59 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 60 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 61 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 62 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 63 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 64 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 65 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 66 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 67 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 68 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 69 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 70 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 71 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 72 | 2820426531 | Unclassified Firmicutes Lab288P3bin45 | Isolate | Unclassified |
| 73 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 74 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 75 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 76 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 77 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 78 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 79 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 80 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 81 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 82 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 83 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 84 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 85 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 86 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 87 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 88 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 89 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 90 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 91 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 92 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 93 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 94 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 95 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 96 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 97 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 98 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 99 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 100 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 101 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 102 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 103 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 104 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 105 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 106 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 107 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 108 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 109 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 110 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 111 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 112 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 113 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 114 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 115 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 116 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 117 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 118 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 119 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 120 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 121 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 122 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 123 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 124 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 125 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 126 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 127 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 128 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 129 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 130 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 131 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 132 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 133 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 134 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 135 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 136 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 137 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 138 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 139 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 140 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 141 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 142 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 143 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 144 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 145 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 146 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 147 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 148 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 149 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 150 | 642555127 | Elusimicrobium minutum Pei191 | Isolate | Unclassified |
| 151 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 152 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 153 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 154 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 155 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 156 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 157 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 158 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 159 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 160 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 161 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 162 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 163 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 164 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 165 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 166 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 167 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 168 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 169 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 170 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 171 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 172 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 173 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 174 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 175 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 176 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 177 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 178 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 179 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 180 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 181 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 182 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 183 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 184 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 185 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 186 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 187 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 188 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 189 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 190 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 191 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 192 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 193 | 2820615445 | Unclassified Firmicutes Emb289P1bin132 | Isolate | Unclassified |
| 194 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 195 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 196 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 197 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 198 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 199 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 200 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 201 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 202 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0539 | 3300056842 | Bacteria | 59504 |
| 2 | Ga0466735_210554 | 3300042624 | Bacteria | 8535 |
| 3 | Ga0466715_507994 | 3300042616 | Bacteria | 16581 |
| 4 | Ga0466656_048102 | 3300042550 | Bacteria | 2562 |
| 5 | Ga0123355_10001760 | 3300009826 | Bacteria | 30282 |
| 6 | Ga0123355_10046860 | 3300009826 | Bacteria | 7029 |
| 7 | Ga0123355_10131747 | 3300009826 | Bacteria | 3851 |
| 8 | Ga0123355_10163328 | 3300009826 | Bacteria | 3349 |
| 9 | Ga0123355_10220889 | 3300009826 | Bacteria | 2725 |
| 10 | Ga0123354_10000005 | 3300010882 | Bacteria | 283385 |
| 11 | Ga0123354_10260857 | 3300010882 | Bacteria | 1731 |
| 12 | Ga0466706_042144 | 3300042599 | Bacteria | 10225 |
| 13 | Ga0466706_143510 | 3300042599 | Bacteria | 7821 |
| 14 | Ga0466700_417079 | 3300042600 | Bacteria | 69635 |
| 15 | HBC_ctgsDRAFT_1007294 | 3300000333 | Bacteria | 2602 |
| 16 | JGI24702J35022_10091595 | 3300002462 | Bacteria | 1655 |
| 17 | JGI24703J35330_11748870 | 3300002501 | Bacteria | 105930 |
| 18 | Ga0052191_101272 | 3300003097 | Bacteria | 4361 |
| 19 | Ga0074278_152631 | 3300005721 | Bacteria | 16819 |
| 20 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 21 | Ga0562379_0390 | 3300056790 | Bacteria | 99119 |
| 22 | Ga0562379_0691 | 3300056790 | Bacteria | 57361 |
| 23 | Ga0562378_0004 | 3300056814 | Bacteria | 2423881 |
| 24 | Ga0562375_0058 | 3300056856 | Bacteria | 444736 |
| 25 | Ga0562375_0076 | 3300056856 | Bacteria | 327447 |
| 26 | Ga0562374_0725 | 3300057007 | Bacteria | 48750 |
| 27 | Ga0562374_2307 | 3300057007 | Unclassified | 17311 |
| 28 | Ga0466729_219538 | 3300042621 | Bacteria | 1656 |
| 29 | Ga0466724_24238 | 3300042649 | Bacteria | 22794 |
| 30 | Ga0466728_388833 | 3300042620 | Bacteria | 1084 |
| 31 | Ga0415639_018935 | 3300038395 | Bacteria | 3817 |
| 32 | Ga0123355_10004922 | 3300009826 | Bacteria | 19444 |
| 33 | Ga0123355_10060561 | 3300009826 | Bacteria | 6113 |
| 34 | Ga0123355_10116829 | 3300009826 | Bacteria | 4150 |
| 35 | Ga0123354_10059934 | 3300010882 | Bacteria | 5639 |
| 36 | Ga0466706_102864 | 3300042599 | Unclassified | 1262 |
| 37 | Ga0466706_145545 | 3300042599 | Bacteria | 24377 |
| 38 | Ga0466713_093617 | 3300042602 | Bacteria | 168801 |
| 39 | Ga0466714_001992 | 3300042603 | Bacteria | 7072 |
| 40 | Ga0466697_048523 | 3300042611 | Bacteria | 1637 |
| 41 | JGI24703J35330_11737512 | 3300002501 | Bacteria | 3117 |
| 42 | JGI24703J35330_11748863 | 3300002501 | Bacteria | 60401 |
| 43 | Ga0466697_245950 | 3300042611 | Bacteria | 1872 |
| 44 | Ga0466733_166009 | 3300042659 | Bacteria | 20223 |
| 45 | Ga0466733_222756 | 3300042659 | Bacteria | 1274 |
| 46 | Ga0562378_0003 | 3300056814 | Bacteria | 2474150 |
| 47 | Ga0466715_136743 | 3300042616 | Bacteria | 15268 |
| 48 | Ga0466656_023402 | 3300042550 | Bacteria | 2875 |
| 49 | Ga0466691_111513 | 3300042593 | Bacteria | 9991 |
| 50 | Ga0466696_362060 | 3300042596 | Bacteria | 3900 |
| 51 | Ga0123355_10006360 | 3300009826 | Bacteria | 17483 |
| 52 | Ga0123355_10184510 | 3300009826 | Bacteria | 3088 |
| 53 | Ga0123356_10228334 | 3300010049 | Bacteria | 1924 |
| 54 | Ga0466701_085341 | 3300042598 | Bacteria | 1516 |
| 55 | Ga0466706_126911 | 3300042599 | Bacteria | 18302 |
| 56 | Ga0466706_260770 | 3300042599 | Bacteria | 2089 |
| 57 | Ga0466722_166910 | 3300042609 | Bacteria | 8418 |
| 58 | 2227080774 | 2225789004 | Bacteria | 191256 |
| 59 | HBC_ctgsDRAFT_1007441 | 3300000333 | Unclassified | 2583 |
| 60 | JGI24703J35330_11747925 | 3300002501 | Bacteria | 9133 |
| 61 | Ga0562374_0037 | 3300057007 | Bacteria | 679104 |
| 62 | Ga0562374_1563 | 3300057007 | Bacteria | 25967 |
| 63 | Ga0466702_444147 | 3300042635 | Bacteria | 77354 |
| 64 | Ga0123355_10266700 | 3300009826 | Bacteria | 2386 |
| 65 | Ga0123356_10041583 | 3300010049 | Bacteria | 4282 |
| 66 | Ga0123356_10052190 | 3300010049 | Bacteria | 3804 |
| 67 | Ga0123356_10623786 | 3300010049 | Bacteria | 1244 |
| 68 | Ga0466713_156550 | 3300042602 | Bacteria | 26644 |
| 69 | Ga0466714_032525 | 3300042603 | Bacteria | 1671 |
| 70 | Ga0466714_058960 | 3300042603 | Bacteria | 1364 |
| 71 | Ga0466717_014730 | 3300042604 | Bacteria | 2331 |
| 72 | Ga0466698_235054 | 3300042610 | Bacteria | 6737 |
| 73 | AglaG_contig19080 | 2084038013 | Bacteria | 11552 |
| 74 | HBC_ctgsDRAFT_1009594 | 3300000333 | Bacteria | 2304 |
| 75 | JGI24695J34938_10045228 | 3300002450 | Bacteria | 1954 |
| 76 | Ga0072941_1013232 | 3300005201 | Bacteria | 98941 |
| 77 | Ga0466705_061829 | 3300042612 | Bacteria | 4351 |
| 78 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 79 | Ga0562379_0258 | 3300056790 | Bacteria | 138793 |
| 80 | Ga0562377_0019 | 3300056842 | Bacteria | 1067000 |
| 81 | Ga0466731_074953 | 3300042622 | Bacteria | 12668 |
| 82 | Ga0466734_122698 | 3300042623 | Bacteria | 1514 |
| 83 | Ga0466715_104811 | 3300042616 | Bacteria | 85178 |
| 84 | Ga0466715_526118 | 3300042616 | Bacteria | 10134 |
| 85 | Ga0466696_119294 | 3300042596 | Bacteria | 103684 |
| 86 | Ga0123355_10000197 | 3300009826 | Bacteria | 74985 |
| 87 | Ga0123355_10000398 | 3300009826 | Bacteria | 56583 |
| 88 | Ga0123355_10007073 | 3300009826 | Bacteria | 16724 |
| 89 | Ga0123355_10079340 | 3300009826 | Bacteria | 5243 |
| 90 | Ga0123356_10014207 | 3300010049 | Bacteria | 7660 |
| 91 | Ga0123356_10026319 | 3300010049 | Bacteria | 5463 |
| 92 | Ga0123353_10048584 | 3300010167 | Bacteria | 6756 |
| 93 | Ga0123353_10714049 | 3300010167 | Bacteria | 1404 |
| 94 | Ga0160464_100300 | 3300012805 | Bacteria | 43427 |
| 95 | Ga0466721_313890 | 3300042608 | Bacteria | 1304 |
| 96 | JGI24703J35330_11659952 | 3300002501 | Bacteria | 1651 |
| 97 | Ga0466697_268564 | 3300042611 | Bacteria | 7551 |
| 98 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 99 | Ga0562379_0273 | 3300056790 | Bacteria | 133845 |
| 100 | Ga0562378_0279 | 3300056814 | Bacteria | 111869 |
| 101 | Ga0562377_0063 | 3300056842 | Bacteria | 461046 |
| 102 | Ga0562376_1355 | 3300056857 | Bacteria | 34916 |
| 103 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 104 | Ga0466731_325219 | 3300042622 | Unclassified | 1129 |
| 105 | Ga0466734_028885 | 3300042623 | Bacteria | 8652 |
| 106 | Ga0466727_251819 | 3300042655 | Bacteria | 21791 |
| 107 | Ga0466710_420998 | 3300042613 | Unclassified | 2373 |
| 108 | Ga0466723_163769 | 3300042618 | Bacteria | 7261 |
| 109 | Ga0466693_221142 | 3300042592 | Bacteria | 1408 |
| 110 | Ga0123355_10000655 | 3300009826 | Bacteria | 46923 |
| 111 | Ga0123355_10157850 | 3300009826 | Bacteria | 3426 |
| 112 | Ga0123356_10037042 | 3300010049 | Bacteria | 4552 |
| 113 | Ga0123356_10440301 | 3300010049 | Bacteria | 1449 |
| 114 | Ga0123354_10086797 | 3300010882 | Bacteria | 4370 |
| 115 | Ga0466706_131104 | 3300042599 | Bacteria | 1692 |
| 116 | Ga0466717_035477 | 3300042604 | Bacteria | 2903 |
| 117 | Ga0466719_448741 | 3300042606 | Bacteria | 6315 |
| 118 | Ga0466722_111932 | 3300042609 | Bacteria | 3587 |
| 119 | IMNBL1DRAFT_c0022113 | 3300000062 | Bacteria | 2525 |
| 120 | JGI24696J40584_12951725 | 3300002834 | Bacteria | 2272 |
| 121 | Ga0562379_0044 | 3300056790 | Bacteria | 597058 |
| 122 | Ga0562377_0106 | 3300056842 | Bacteria | 268063 |
| 123 | Ga0466735_079367 | 3300042624 | Bacteria | 15650 |
| 124 | Ga0466735_186761 | 3300042624 | Unclassified | 1849 |
| 125 | Ga0466725_334262 | 3300042654 | Bacteria | 3979 |
| 126 | Ga0466715_515269 | 3300042616 | Bacteria | 14969 |
| 127 | Ga0466718_026832 | 3300042617 | Bacteria | 2607 |
| 128 | Ga0415639_149871 | 3300038395 | Bacteria | 4189 |
| 129 | Ga0415639_154225 | 3300038395 | Bacteria | 5751 |
| 130 | Ga0123355_10031547 | 3300009826 | Bacteria | 8597 |
| 131 | Ga0123356_10315893 | 3300010049 | Bacteria | 1673 |
| 132 | Ga0466706_098812 | 3300042599 | Bacteria | 5702 |
| 133 | Ga0466717_041446 | 3300042604 | Bacteria | 3723 |
| 134 | JGI24703J35330_11748746 | 3300002501 | Bacteria | 30877 |
| 135 | JGI24705J35276_12233675 | 3300002504 | Unclassified | 4984 |
| 136 | JGI24705J35276_12235654 | 3300002504 | Bacteria | 6782 |
| 137 | JGI24700J35501_10930890 | 3300002508 | Bacteria | 34676 |
| 138 | Ga0063521_1009068 | 3300003973 | Unclassified | 2377 |
| 139 | Ga0068302_10166889 | 3300005071 | Bacteria | 3642 |
| 140 | Ga0123357_10000254 | 3300009784 | Bacteria | 51081 |
| 141 | Ga0466697_279123 | 3300042611 | Bacteria | 2973 |
| 142 | Ga0562377_1775 | 3300056842 | Bacteria | 19874 |
| 143 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 144 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 145 | Ga0123355_10000304 | 3300009826 | Bacteria | 63149 |
| 146 | Ga0123355_10158773 | 3300009826 | Bacteria | 3413 |
| 147 | Ga0123353_10062751 | 3300010167 | Unclassified | 5960 |
| 148 | Ga0123353_10800567 | 3300010167 | Bacteria | 1301 |
| 149 | Ga0123354_10088389 | 3300010882 | Bacteria | 4309 |
| 150 | Ga0466707_082502 | 3300042601 | Bacteria | 39523 |
| 151 | IMNBL1DRAFT_c0001375 | 3300000062 | Bacteria | 18278 |
| 152 | HBC_ctgsDRAFT_1009725 | 3300000333 | Unclassified | 2291 |
| 153 | JGI24703J35330_11748754 | 3300002501 | Bacteria | 31354 |
| 154 | CVPL010L_1001214 | 3300002932 | Unclassified | 8097 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02562 | GO:0005524 | ATP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.