Protein Family IF10368
Metagenome
Metatranscriptome
Isolate
112
Members
47
Samples
106
Scaffolds
87.76
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_203653|Ga0466733_203653_1034_1345
- Length
- 103 aa
- Sequence
- LRVAFDEKAFAEYTEWQFTDKRVLKRINELIRSITRDGFMRGIGKPEVLKSRKAYSRRIDEANRLVYIGDSEQNIIILSCKGHYDDWKSISSLSSCVKDFNSL
Sample Types
Isolate
5.4%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
60.9%
Unclassified
13.0%
Kalotermitidae
8.7%
Termopsidae
6.5%
Rhinotermitidae
4.3%
Elmidae
2.2%
Hodotermitidae
2.2%
Passalidae
2.2%
Taxonomy
Archaea
2
Bacteria
103
Eukaryota
0
Viruses
1
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 2 | 2820903739 | Unclassified Actinobacteria Emb289P4bin49 | Isolate | Unclassified |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 7 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 8 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 27 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 30 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10510968 | 3300010049 | Bacteria | 1359 |
| 2 | Ga0123353_11374286 | 3300010167 | Unclassified | 910 |
| 3 | Ga0123354_10190461 | 3300010882 | Bacteria | 2299 |
| 4 | JGI24695J34938_10045900 | 3300002450 | Bacteria | 1935 |
| 5 | Ga0466706_189608 | 3300042599 | Bacteria | 1303 |
| 6 | Ga0466693_023597 | 3300042592 | Bacteria | 2156 |
| 7 | Ga0466699_375964 | 3300042597 | Bacteria | 1175 |
| 8 | Ga0466735_194819 | 3300042624 | Bacteria | 1332 |
| 9 | Ga0466702_147307 | 3300042635 | Bacteria | 1048 |
| 10 | Ga0466727_299800 | 3300042655 | Bacteria | 1131 |
| 11 | Ga0123357_10007964 | 3300009784 | Unclassified | 13181 |
| 12 | Ga0123356_10712710 | 3300010049 | Bacteria | 1173 |
| 13 | Ga0123356_11510418 | 3300010049 | Bacteria | 829 |
| 14 | Ga0123354_10497518 | 3300010882 | Archaea | 952 |
| 15 | IMNBL1DRAFT_c0014727 | 3300000062 | Bacteria | 3431 |
| 16 | Ga0466717_203393 | 3300042604 | Bacteria | 1023 |
| 17 | Ga0466720_162134 | 3300042607 | Bacteria | 1233 |
| 18 | Ga0466712_134544 | 3300042614 | Bacteria | 8445 |
| 19 | Ga0466726_032620 | 3300042619 | Bacteria | 2764 |
| 20 | Ga0466726_096315 | 3300042619 | Bacteria | 3237 |
| 21 | Ga0466657_142422 | 3300042582 | Bacteria | 1061 |
| 22 | Ga0466704_455691 | 3300042643 | Bacteria | 1302 |
| 23 | Ga0466727_279684 | 3300042655 | Bacteria | 1369 |
| 24 | Ga0123355_10249744 | 3300009826 | Bacteria | 2500 |
| 25 | Ga0466712_152551 | 3300042614 | Bacteria | 6639 |
| 26 | Ga0466726_268978 | 3300042619 | Bacteria | 1371 |
| 27 | Ga0466656_065044 | 3300042550 | Bacteria | 1492 |
| 28 | Ga0466697_151663 | 3300042611 | Bacteria | 3354 |
| 29 | Ga0466705_050454 | 3300042612 | Bacteria | 1400 |
| 30 | Ga0466729_304545 | 3300042621 | Bacteria | 4822 |
| 31 | Ga0123356_11857890 | 3300010049 | Bacteria | 749 |
| 32 | Ga0123353_12015438 | 3300010167 | Bacteria | 706 |
| 33 | JGI24695J34938_10217234 | 3300002450 | Bacteria | 801 |
| 34 | Ga0466733_113572 | 3300042659 | Bacteria | 3006 |
| 35 | Ga0466707_075299 | 3300042601 | Bacteria | 2609 |
| 36 | Ga0466714_159943 | 3300042603 | Bacteria | 3416 |
| 37 | Ga0466705_468099 | 3300042612 | Bacteria | 10350 |
| 38 | Ga0466712_095960 | 3300042614 | Bacteria | 3715 |
| 39 | Ga0466712_180697 | 3300042614 | Bacteria | 4973 |
| 40 | Ga0466726_147804 | 3300042619 | Bacteria | 1180 |
| 41 | Ga0255786_1020556 | 3300022815 | Bacteria | 1253 |
| 42 | Ga0466691_008764 | 3300042593 | Bacteria | 1069 |
| 43 | Ga0466705_058859 | 3300042612 | Bacteria | 2287 |
| 44 | Ga0123356_10797728 | 3300010049 | Bacteria | 1115 |
| 45 | Ga0123356_12582362 | 3300010049 | Bacteria | 636 |
| 46 | Nasutiter_FTJKGMZ01B35HN | 2030936001 | Bacteria | 524 |
| 47 | AustNasuHG_c1025291 | 3300000089 | Bacteria | 1867 |
| 48 | Ga0466714_041472 | 3300042603 | Unclassified | 1874 |
| 49 | Ga0466715_117381 | 3300042616 | Bacteria | 3965 |
| 50 | Ga0415639_135647 | 3300038395 | Bacteria | 2705 |
| 51 | Ga0466657_030820 | 3300042582 | Bacteria | 1498 |
| 52 | Ga0466704_066598 | 3300042643 | Bacteria | 1094 |
| 53 | Ga0466727_239570 | 3300042655 | Bacteria | 1154 |
| 54 | Ga0123355_10482110 | 3300009826 | Bacteria | 1542 |
| 55 | Ga0123353_10000180 | 3300010167 | Bacteria | 80622 |
| 56 | Ga0123354_10240164 | 3300010882 | Bacteria | 1866 |
| 57 | IMNBL1DRAFT_c0087181 | 3300000062 | Bacteria | 862 |
| 58 | JGI24695J34938_10057567 | 3300002450 | Bacteria | 1670 |
| 59 | JGI24702J35022_10017279 | 3300002462 | Bacteria | 3943 |
| 60 | Ga0466733_115915 | 3300042659 | Bacteria | 3855 |
| 61 | Ga0466733_203653 | 3300042659 | Bacteria | 1874 |
| 62 | Ga0466706_219275 | 3300042599 | Bacteria | 1143 |
| 63 | Ga0466700_163277 | 3300042600 | Bacteria | 2067 |
| 64 | Ga0466705_397572 | 3300042612 | Bacteria | 2007 |
| 65 | Ga0466697_195521 | 3300042611 | Bacteria | 17447 |
| 66 | Ga0466705_160749 | 3300042612 | Bacteria | 3263 |
| 67 | Ga0466702_022861 | 3300042635 | Bacteria | 1781 |
| 68 | Ga0466704_113407 | 3300042643 | Bacteria | 51738 |
| 69 | Ga0123357_10371949 | 3300009784 | Bacteria | 1338 |
| 70 | Ga0123356_11103790 | 3300010049 | Bacteria | 961 |
| 71 | Ga0123356_11812014 | 3300010049 | Unclassified | 759 |
| 72 | Ga0123356_13965556 | 3300010049 | Bacteria | 510 |
| 73 | JGI24695J34938_10108516 | 3300002450 | Bacteria | 1132 |
| 74 | JGI24702J35022_10139825 | 3300002462 | Bacteria | 1350 |
| 75 | Ga0072940_1419380 | 3300005200 | Viruses | 523 |
| 76 | Ga0072941_1153993 | 3300005201 | Bacteria | 921 |
| 77 | Ga0466706_213635 | 3300042599 | Bacteria | 3277 |
| 78 | Ga0466706_278720 | 3300042599 | Unclassified | 1725 |
| 79 | Ga0466707_015209 | 3300042601 | Bacteria | 1093 |
| 80 | Ga0466721_322620 | 3300042608 | Bacteria | 6664 |
| 81 | Ga0466705_453736 | 3300042612 | Bacteria | 30628 |
| 82 | Ga0466712_001703 | 3300042614 | Bacteria | 1291 |
| 83 | Ga0466726_065590 | 3300042619 | Unclassified | 1389 |
| 84 | Ga0415639_199094 | 3300038395 | Bacteria | 2198 |
| 85 | Ga0466694_040712 | 3300042594 | Bacteria | 1655 |
| 86 | Ga0466697_122071 | 3300042611 | Bacteria | 3887 |
| 87 | Ga0466730_017028 | 3300042625 | Bacteria | 1258 |
| 88 | Ga0466725_126997 | 3300042654 | Bacteria | 6280 |
| 89 | Ga0123356_10322092 | 3300010049 | Bacteria | 1659 |
| 90 | Ga0123356_10434072 | 3300010049 | Bacteria | 1458 |
| 91 | Ga0123356_10674661 | 3300010049 | Bacteria | 1201 |
| 92 | Ga0466733_130776 | 3300042659 | Bacteria | 1449 |
| 93 | Ga0466706_255984 | 3300042599 | Bacteria | 8537 |
| 94 | Ga0466706_278606 | 3300042599 | Bacteria | 6614 |
| 95 | Ga0466726_012091 | 3300042619 | Bacteria | 3606 |
| 96 | Ga0466726_180818 | 3300042619 | Bacteria | 1908 |
| 97 | Ga0466726_333938 | 3300042619 | Bacteria | 1097 |
| 98 | Ga0415639_096596 | 3300038395 | Bacteria | 1354 |
| 99 | Ga0466657_360001 | 3300042582 | Bacteria | 1346 |
| 100 | Ga0466692_005921 | 3300042591 | Bacteria | 3923 |
| 101 | Ga0466705_047307 | 3300042612 | Archaea | 1932 |
| 102 | Ga0466702_074865 | 3300042635 | Bacteria | 18472 |
| 103 | Ga0466702_199186 | 3300042635 | Bacteria | 1478 |
| 104 | Ga0466702_308645 | 3300042635 | Bacteria | 3600 |
| 105 | Ga0466702_438526 | 3300042635 | Bacteria | 2315 |
| 106 | Ga0466727_236825 | 3300042655 | Bacteria | 1314 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06769 | YoeB_toxin | YoeB-like toxin of bacterial type II toxin-antitoxin system | 5 | 84 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.