Protein Family IF10286
Metagenome
Isolate
569
Members
273
Samples
363
Scaffolds
208.88
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_040534|Ga0466733_040534_1171_1866
- Length
- 231 aa
- Sequence
- MFALSKLVKKRDMNNDKEPLFSAKNIKLITAPLGAQNPITIQVLGICSALAVTAKLEPAIVMGISVIFVVVFSNLIISLLRNTIPARIRIIVQLVVVAALVILVDQILRAYAYEVSLQLSVFVGLIITNCILMGRLEAFALGNKPWQSVLDGIGNGAGYAMILVIVAVLRELFGSGTLTMPYFGELRIIPPTFYDFGYANNGLMILPPMALIVVGVIIWIQRARNKELIEK
Sample Types
Isolate
36.2%
Metagenome
63.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
38.5%
Termitidae
10.1%
Blattidae
8.9%
Kalotermitidae
5.4%
Anthocoridae
5.1%
Drosophilidae
4.3%
Elmidae
3.1%
Tenebrionidae
3.1%
Rhinotermitidae
1.6%
Termopsidae
1.6%
Cerambycidae
1.6%
Palinuridae
1.2%
Culicidae
1.2%
Nephropidae
1.2%
Pteromalidae
1.2%
Tephritidae
1.2%
Apidae
1.2%
Talitridae
1.2%
Majidae
0.8%
Passalidae
0.8%
Calliphoridae
0.8%
Curculionidae
0.8%
Lysianassidae
0.4%
Daphniidae
0.4%
Hodotermitidae
0.4%
Ceratophyllidae
0.4%
Formicidae
0.4%
Aphididae
0.4%
Armadillidiidae
0.4%
Crambidae
0.4%
Hippoboscidae
0.4%
Artemiidae
0.4%
Pentatomidae
0.4%
Rhopalidae
0.4%
Penaeidae
0.4%
Plutellidae
0.4%
Taxonomy
Archaea
0
Bacteria
534
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 3 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 4 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 5 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 6 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 7 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 8 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 9 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 10 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 11 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 12 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 13 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 14 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 15 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 16 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 17 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 18 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 19 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 20 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 21 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 22 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 23 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 24 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 25 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 26 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 27 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 28 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 29 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 36 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 37 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 38 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 39 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 40 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 41 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 44 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 45 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 46 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 49 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 50 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 51 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 52 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 53 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 54 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 55 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 56 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 57 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 58 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 59 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 60 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 61 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 62 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 63 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 64 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 65 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 66 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 67 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 68 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 69 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 70 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 71 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 72 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 73 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 74 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 75 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 76 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 77 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 78 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 79 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 80 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 81 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 82 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 83 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 84 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 85 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 86 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 87 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 88 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 89 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 90 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 91 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 92 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 93 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 94 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 95 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 96 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 97 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 98 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 99 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 100 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 101 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 102 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 103 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 104 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 105 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 106 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 107 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 108 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 109 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 110 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 111 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 112 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 113 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 114 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 115 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 116 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 117 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 118 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 119 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 120 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 121 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 122 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 123 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 124 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 125 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 126 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 127 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 128 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 129 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 130 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 131 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 132 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 133 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 134 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 135 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 136 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 137 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 138 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 139 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 140 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 141 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 142 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 143 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 144 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 145 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 146 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 147 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 148 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 149 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 150 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 151 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 152 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 153 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 154 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 155 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 156 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 157 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 158 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 159 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 160 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 161 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 162 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 163 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 164 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 165 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 166 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 167 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 168 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 169 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 170 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 171 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 172 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 173 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 174 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 175 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 176 | 2839785767 | Thalassobius sp. I31.1 | Isolate | Nephropidae |
| 177 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 178 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 179 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 180 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 181 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 182 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 183 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 184 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 185 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 186 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 187 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 188 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 189 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 190 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 191 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 192 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 193 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 194 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 195 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 196 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 197 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 198 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 199 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 200 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 201 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 202 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 203 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 204 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 205 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 206 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 207 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 208 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 209 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 210 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 211 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 212 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 213 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 214 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 215 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 216 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 217 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 218 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 219 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 220 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 221 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 222 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 223 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 224 | 2958255616 | Serratia marcescens TM | Isolate | |
| 225 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 226 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 227 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 228 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 229 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 230 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 231 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 232 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 233 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 234 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 235 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 236 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 237 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 238 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 239 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 240 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 241 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 242 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 243 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 244 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 245 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 246 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 247 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 248 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 249 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 250 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 251 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 252 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 253 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 254 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 255 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 256 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 257 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 258 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 259 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 260 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 261 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 262 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 263 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 264 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 265 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 266 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 267 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 268 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 269 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 270 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 271 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 272 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 273 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_044617 | 3300042659 | Bacteria | 6263 |
| 2 | Ga0466733_168697 | 3300042659 | Bacteria | 2139 |
| 3 | Ga0415639_178609 | 3300038395 | Bacteria | 1926 |
| 4 | Ga0466692_004440 | 3300042591 | Bacteria | 16966 |
| 5 | Ga0466692_036816 | 3300042591 | Bacteria | 10764 |
| 6 | Ga0466691_204801 | 3300042593 | Bacteria | 98819 |
| 7 | Ga0466695_349888 | 3300042595 | Bacteria | 1779 |
| 8 | Ga0466696_036731 | 3300042596 | Bacteria | 2422 |
| 9 | Ga0466696_280340 | 3300042596 | Bacteria | 1840 |
| 10 | Ga0466705_416513 | 3300042612 | Bacteria | 21390 |
| 11 | Ga0466712_194116 | 3300042614 | Bacteria | 3349 |
| 12 | Ga0466711_201458 | 3300042615 | Unclassified | 1417 |
| 13 | Ga0466723_113602 | 3300042618 | Bacteria | 14980 |
| 14 | Ga0466728_079130 | 3300042620 | Bacteria | 8036 |
| 15 | Ga0466731_041947 | 3300042622 | Bacteria | 1726 |
| 16 | Ga0466703_138801 | 3300042636 | Bacteria | 11004 |
| 17 | Ga0466709_049509 | 3300042648 | Bacteria | 2631 |
| 18 | Ga0466724_21658 | 3300042649 | Unclassified | 10132 |
| 19 | Ga0466708_257062 | 3300042652 | Bacteria | 8906 |
| 20 | Ga0466727_201474 | 3300042655 | Bacteria | 4015 |
| 21 | Ga0466727_258122 | 3300042655 | Bacteria | 10241 |
| 22 | Ga0466706_044971 | 3300042599 | Bacteria | 1409 |
| 23 | Ga0466706_080946 | 3300042599 | Bacteria | 26687 |
| 24 | Ga0466707_399267 | 3300042601 | Bacteria | 4469 |
| 25 | Ga0466713_111742 | 3300042602 | Bacteria | 33326 |
| 26 | Ga0466714_067861 | 3300042603 | Bacteria | 1098 |
| 27 | Ga0466714_086222 | 3300042603 | Unclassified | 1943 |
| 28 | Ga0466716_207778 | 3300042605 | Bacteria | 2290 |
| 29 | Ga0466719_511376 | 3300042606 | Bacteria | 1708 |
| 30 | Ga0466722_168075 | 3300042609 | Bacteria | 2106 |
| 31 | FGTW_contig07552 | 2065487013 | Bacteria | 3365 |
| 32 | JGI24702J35022_10001540 | 3300002462 | Bacteria | 14299 |
| 33 | Meta3P_1000327 | 3300002464 | Bacteria | 44626 |
| 34 | CVPL010L_1000066 | 3300002932 | Bacteria | 68154 |
| 35 | Ga0068302_10003377 | 3300005071 | Bacteria | 18657 |
| 36 | Ga0068302_10208327 | 3300005071 | Bacteria | 1909 |
| 37 | Ga0072941_1173150 | 3300005201 | Bacteria | 2269 |
| 38 | Ga0127645_106100 | 3300009461 | Bacteria | 2543 |
| 39 | Ga0466705_031674 | 3300042612 | Bacteria | 10939 |
| 40 | Ga0123356_11461707 | 3300010049 | Bacteria | 842 |
| 41 | Ga0123353_10479950 | 3300010167 | Bacteria | 1819 |
| 42 | Ga0123354_10000260 | 3300010882 | Bacteria | 47442 |
| 43 | Ga0466657_256810 | 3300042582 | Bacteria | 7641 |
| 44 | Ga0466657_360893 | 3300042582 | Bacteria | 1519 |
| 45 | Ga0466693_169528 | 3300042592 | Bacteria | 1066 |
| 46 | Ga0466691_112123 | 3300042593 | Bacteria | 11372 |
| 47 | Ga0466696_093390 | 3300042596 | Bacteria | 8249 |
| 48 | Ga0466696_459820 | 3300042596 | Bacteria | 13140 |
| 49 | Ga0466710_132532 | 3300042613 | Bacteria | 1627 |
| 50 | Ga0466715_113213 | 3300042616 | Bacteria | 91663 |
| 51 | Ga0466728_181965 | 3300042620 | Bacteria | 5621 |
| 52 | Ga0466729_106723 | 3300042621 | Bacteria | 9657 |
| 53 | Ga0466735_039069 | 3300042624 | Bacteria | 2704 |
| 54 | Ga0466735_079969 | 3300042624 | Bacteria | 1542 |
| 55 | Ga0466703_242939 | 3300042636 | Bacteria | 13750 |
| 56 | Ga0466703_337667 | 3300042636 | Bacteria | 3420 |
| 57 | Ga0466709_042012 | 3300042648 | Bacteria | 35741 |
| 58 | Ga0466708_040388 | 3300042652 | Bacteria | 5342 |
| 59 | Ga0466727_118285 | 3300042655 | Bacteria | 7758 |
| 60 | Ga0466727_312161 | 3300042655 | Bacteria | 1412 |
| 61 | Ga0466706_040201 | 3300042599 | Bacteria | 1174 |
| 62 | Ga0466706_042546 | 3300042599 | Bacteria | 10696 |
| 63 | Ga0466706_060170 | 3300042599 | Bacteria | 4114 |
| 64 | Ga0466706_109717 | 3300042599 | Bacteria | 38259 |
| 65 | Ga0466706_173670 | 3300042599 | Bacteria | 12610 |
| 66 | Ga0466714_029632 | 3300042603 | Bacteria | 4101 |
| 67 | Ga0466714_048050 | 3300042603 | Bacteria | 1801 |
| 68 | Ga0466714_100063 | 3300042603 | Unclassified | 2141 |
| 69 | Ga0466714_145654 | 3300042603 | Unclassified | 1558 |
| 70 | Ga0466716_025191 | 3300042605 | Bacteria | 12762 |
| 71 | Ga0466716_243330 | 3300042605 | Bacteria | 6841 |
| 72 | Ga0466716_274859 | 3300042605 | Bacteria | 4321 |
| 73 | Ga0466719_432275 | 3300042606 | Bacteria | 4698 |
| 74 | Ga0466719_497555 | 3300042606 | Bacteria | 2639 |
| 75 | Ga0466698_265668 | 3300042610 | Bacteria | 3561 |
| 76 | IMNBL1DRAFT_c0056065 | 3300000062 | Bacteria | 1211 |
| 77 | JGI24702J35022_10034267 | 3300002462 | Bacteria | 2716 |
| 78 | JGI24702J35022_10036946 | 3300002462 | Unclassified | 2610 |
| 79 | Ga0104050_1001690 | 3300007153 | Bacteria | 2739 |
| 80 | Ga0466705_334704 | 3300042612 | Bacteria | 3317 |
| 81 | Ga0466732_448102 | 3300042656 | Bacteria | 5319 |
| 82 | Ga0123357_10004058 | 3300009784 | Bacteria | 17050 |
| 83 | Ga0466690_003302 | 3300042590 | Bacteria | 7319 |
| 84 | Ga0466690_253108 | 3300042590 | Bacteria | 6827 |
| 85 | Ga0466690_431109 | 3300042590 | Unclassified | 2883 |
| 86 | Ga0466692_071360 | 3300042591 | Bacteria | 7014 |
| 87 | Ga0466691_093774 | 3300042593 | Bacteria | 7688 |
| 88 | Ga0466696_155705 | 3300042596 | Bacteria | 27338 |
| 89 | Ga0466696_278891 | 3300042596 | Bacteria | 171866 |
| 90 | Ga0466705_463596 | 3300042612 | Bacteria | 1605 |
| 91 | Ga0466711_187976 | 3300042615 | Bacteria | 8132 |
| 92 | Ga0466711_353681 | 3300042615 | Bacteria | 8516 |
| 93 | Ga0466711_363996 | 3300042615 | Bacteria | 1878 |
| 94 | Ga0466715_277547 | 3300042616 | Bacteria | 9725 |
| 95 | Ga0466715_557528 | 3300042616 | Bacteria | 9946 |
| 96 | Ga0466723_036058 | 3300042618 | Bacteria | 2546 |
| 97 | Ga0466728_107128 | 3300042620 | Bacteria | 57029 |
| 98 | Ga0466728_122860 | 3300042620 | Bacteria | 67185 |
| 99 | Ga0466728_249094 | 3300042620 | Bacteria | 125538 |
| 100 | Ga0466729_030724 | 3300042621 | Bacteria | 14886 |
| 101 | Ga0466729_116407 | 3300042621 | Bacteria | 45416 |
| 102 | Ga0466731_153374 | 3300042622 | Bacteria | 2596 |
| 103 | Ga0466730_084074 | 3300042625 | Unclassified | 3734 |
| 104 | Ga0466704_174384 | 3300042643 | Bacteria | 1596 |
| 105 | Ga0466709_027920 | 3300042648 | Bacteria | 18003 |
| 106 | Ga0466709_240386 | 3300042648 | Bacteria | 67601 |
| 107 | Ga0466727_034689 | 3300042655 | Bacteria | 22385 |
| 108 | Ga0466706_275237 | 3300042599 | Bacteria | 8325 |
| 109 | Ga0466713_021467 | 3300042602 | Bacteria | 36702 |
| 110 | Ga0466713_143501 | 3300042602 | Bacteria | 19137 |
| 111 | Ga0466714_021925 | 3300042603 | Bacteria | 4489 |
| 112 | Ga0466714_071171 | 3300042603 | Bacteria | 8163 |
| 113 | Ga0466716_060132 | 3300042605 | Bacteria | 7699 |
| 114 | Ga0466716_287877 | 3300042605 | Bacteria | 7491 |
| 115 | IMNBL1DRAFT_c0000253 | 3300000062 | Bacteria | 47393 |
| 116 | IMNBL1DRAFT_c0005227 | 3300000062 | Bacteria | 7496 |
| 117 | JGI24702J35022_10001957 | 3300002462 | Bacteria | 12693 |
| 118 | Ga0063521_1000062 | 3300003973 | Bacteria | 94430 |
| 119 | Ga0068305_10320474 | 3300005083 | Bacteria | 1212 |
| 120 | Ga0072941_1165319 | 3300005201 | Bacteria | 7877 |
| 121 | Ga0072941_1197209 | 3300005201 | Bacteria | 5832 |
| 122 | Ga0105008_1092772 | 3300007507 | Unclassified | 2538 |
| 123 | Ga0466733_039484 | 3300042659 | Bacteria | 48204 |
| 124 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 125 | Ga0123356_10224791 | 3300010049 | Bacteria | 1936 |
| 126 | Ga0123353_10000048 | 3300010167 | Bacteria | 132187 |
| 127 | Ga0160468_102152 | 3300012819 | Bacteria | 3690 |
| 128 | Ga0466690_037079 | 3300042590 | Bacteria | 8628 |
| 129 | Ga0466692_046708 | 3300042591 | Bacteria | 150257 |
| 130 | Ga0466692_117651 | 3300042591 | Bacteria | 11912 |
| 131 | Ga0466691_070243 | 3300042593 | Bacteria | 28689 |
| 132 | Ga0466712_306028 | 3300042614 | Bacteria | 2206 |
| 133 | Ga0466711_380607 | 3300042615 | Bacteria | 1212 |
| 134 | Ga0466715_108409 | 3300042616 | Bacteria | 27069 |
| 135 | Ga0466723_039493 | 3300042618 | Bacteria | 2360 |
| 136 | Ga0466723_109178 | 3300042618 | Bacteria | 21683 |
| 137 | Ga0466723_204091 | 3300042618 | Bacteria | 19692 |
| 138 | Ga0466726_006129 | 3300042619 | Bacteria | 11303 |
| 139 | Ga0466726_012021 | 3300042619 | Bacteria | 19051 |
| 140 | Ga0466735_026501 | 3300042624 | Bacteria | 6657 |
| 141 | Ga0466703_071102 | 3300042636 | Bacteria | 7949 |
| 142 | Ga0466703_325807 | 3300042636 | Bacteria | 3600 |
| 143 | Ga0466704_101743 | 3300042643 | Unclassified | 1223 |
| 144 | Ga0466709_050953 | 3300042648 | Bacteria | 5829 |
| 145 | Ga0466709_304202 | 3300042648 | Bacteria | 34829 |
| 146 | Ga0466709_351602 | 3300042648 | Bacteria | 2816 |
| 147 | Ga0466708_056184 | 3300042652 | Bacteria | 24631 |
| 148 | Ga0466708_065719 | 3300042652 | Bacteria | 27310 |
| 149 | Ga0466708_329017 | 3300042652 | Bacteria | 5718 |
| 150 | Ga0466727_201602 | 3300042655 | Bacteria | 1283 |
| 151 | Ga0466701_037181 | 3300042598 | Bacteria | 1107 |
| 152 | Ga0466706_085634 | 3300042599 | Bacteria | 10188 |
| 153 | Ga0466706_131508 | 3300042599 | Bacteria | 13139 |
| 154 | Ga0466700_295612 | 3300042600 | Bacteria | 3479 |
| 155 | Ga0466700_492515 | 3300042600 | Bacteria | 13946 |
| 156 | Ga0466713_133306 | 3300042602 | Bacteria | 44771 |
| 157 | Ga0466714_018458 | 3300042603 | Bacteria | 1067 |
| 158 | Ga0466714_042919 | 3300042603 | Bacteria | 42705 |
| 159 | Ga0466714_066014 | 3300042603 | Bacteria | 5444 |
| 160 | Ga0466714_116060 | 3300042603 | Bacteria | 1872 |
| 161 | Ga0466714_116984 | 3300042603 | Bacteria | 48613 |
| 162 | Ga0466714_151608 | 3300042603 | Bacteria | 2048 |
| 163 | Ga0466716_036371 | 3300042605 | Bacteria | 7571 |
| 164 | Ga0466719_061517 | 3300042606 | Bacteria | 8094 |
| 165 | Ga0466719_175964 | 3300042606 | Bacteria | 1666 |
| 166 | Ga0466719_313021 | 3300042606 | Bacteria | 2447 |
| 167 | Ga0466722_016720 | 3300042609 | Bacteria | 11265 |
| 168 | Ga0466722_098516 | 3300042609 | Bacteria | 64476 |
| 169 | Ga0466722_125809 | 3300042609 | Bacteria | 8799 |
| 170 | Ga0466698_231128 | 3300042610 | Bacteria | 6341 |
| 171 | DPOL_contig12827 | 2035918003 | Bacteria | 7565 |
| 172 | 2227136350 | 2225789004 | Bacteria | 37050 |
| 173 | JGI24702J35022_10082955 | 3300002462 | Bacteria | 1738 |
| 174 | Ga0466697_213200 | 3300042611 | Bacteria | 5007 |
| 175 | Ga0466733_140743 | 3300042659 | Bacteria | 4808 |
| 176 | Ga0466733_210826 | 3300042659 | Bacteria | 17624 |
| 177 | Ga0123356_10286854 | 3300010049 | Bacteria | 1744 |
| 178 | Ga0123353_10134968 | 3300010167 | Bacteria | 3958 |
| 179 | Ga0123353_11161315 | 3300010167 | Bacteria | 1018 |
| 180 | Ga0415639_168973 | 3300038395 | Bacteria | 1147 |
| 181 | Ga0466656_322596 | 3300042550 | Bacteria | 1163 |
| 182 | Ga0466690_021090 | 3300042590 | Bacteria | 16465 |
| 183 | Ga0466690_128303 | 3300042590 | Bacteria | 5884 |
| 184 | Ga0466690_129026 | 3300042590 | Bacteria | 6489 |
| 185 | Ga0466690_134399 | 3300042590 | Bacteria | 25770 |
| 186 | Ga0466696_126815 | 3300042596 | Bacteria | 2884 |
| 187 | Ga0466696_323023 | 3300042596 | Bacteria | 35296 |
| 188 | Ga0466699_434544 | 3300042597 | Bacteria | 3216 |
| 189 | Ga0466711_010847 | 3300042615 | Bacteria | 41256 |
| 190 | Ga0466711_367628 | 3300042615 | Bacteria | 7424 |
| 191 | Ga0466715_279960 | 3300042616 | Bacteria | 9218 |
| 192 | Ga0466726_229068 | 3300042619 | Bacteria | 3157 |
| 193 | Ga0466728_058767 | 3300042620 | Bacteria | 6135 |
| 194 | Ga0466735_010209 | 3300042624 | Bacteria | 2325 |
| 195 | Ga0466735_193353 | 3300042624 | Bacteria | 1629 |
| 196 | Ga0466730_088124 | 3300042625 | Bacteria | 28410 |
| 197 | Ga0466703_056798 | 3300042636 | Bacteria | 103240 |
| 198 | Ga0466703_154324 | 3300042636 | Bacteria | 8729 |
| 199 | Ga0466703_248371 | 3300042636 | Bacteria | 11778 |
| 200 | Ga0466703_345447 | 3300042636 | Bacteria | 5553 |
| 201 | Ga0466703_422528 | 3300042636 | Bacteria | 1810 |
| 202 | Ga0466704_083852 | 3300042643 | Bacteria | 33308 |
| 203 | Ga0466704_098235 | 3300042643 | Bacteria | 11687 |
| 204 | Ga0466704_318155 | 3300042643 | Bacteria | 14579 |
| 205 | Ga0466709_246782 | 3300042648 | Bacteria | 15792 |
| 206 | Ga0466701_050122 | 3300042598 | Bacteria | 33589 |
| 207 | Ga0466706_092711 | 3300042599 | Bacteria | 1184 |
| 208 | Ga0466706_216519 | 3300042599 | Unclassified | 1602 |
| 209 | Ga0466700_491151 | 3300042600 | Bacteria | 3697 |
| 210 | Ga0466707_113572 | 3300042601 | Bacteria | 2315 |
| 211 | Ga0466707_371738 | 3300042601 | Unclassified | 1568 |
| 212 | Ga0466714_068131 | 3300042603 | Bacteria | 8263 |
| 213 | Ga0466714_081495 | 3300042603 | Bacteria | 3101 |
| 214 | Ga0466714_084722 | 3300042603 | Bacteria | 1248 |
| 215 | Ga0466714_089638 | 3300042603 | Unclassified | 3927 |
| 216 | Ga0466716_102185 | 3300042605 | Bacteria | 9699 |
| 217 | Ga0466716_246744 | 3300042605 | Bacteria | 11472 |
| 218 | Ga0466716_265397 | 3300042605 | Bacteria | 6018 |
| 219 | JGI24702J35022_10004435 | 3300002462 | Bacteria | 8338 |
| 220 | Ga0068302_10014386 | 3300005071 | Bacteria | 15150 |
| 221 | Ga0068305_10036006 | 3300005083 | Bacteria | 42333 |
| 222 | Ga0068305_10125970 | 3300005083 | Bacteria | 9769 |
| 223 | Ga0105553_1041634 | 3300007767 | Unclassified | 8564 |
| 224 | Ga0466705_117204 | 3300042612 | Bacteria | 13174 |
| 225 | Ga0466733_006858 | 3300042659 | Bacteria | 5486 |
| 226 | Ga0466733_040534 | 3300042659 | Bacteria | 3473 |
| 227 | Ga0123356_10025921 | 3300010049 | Bacteria | 5511 |
| 228 | Ga0123356_10852815 | 3300010049 | Bacteria | 1082 |
| 229 | Ga0123353_10000002 | 3300010167 | Bacteria | 351672 |
| 230 | Ga0123354_10031206 | 3300010882 | Bacteria | 8362 |
| 231 | Ga0466690_036477 | 3300042590 | Bacteria | 37654 |
| 232 | Ga0466690_303990 | 3300042590 | Bacteria | 12416 |
| 233 | Ga0466692_102841 | 3300042591 | Bacteria | 1217 |
| 234 | Ga0466691_011475 | 3300042593 | Bacteria | 15015 |
| 235 | Ga0466691_161367 | 3300042593 | Unclassified | 2971 |
| 236 | Ga0466696_299748 | 3300042596 | Bacteria | 18305 |
| 237 | Ga0466699_043207 | 3300042597 | Unclassified | 2311 |
| 238 | Ga0466711_020973 | 3300042615 | Bacteria | 1715 |
| 239 | Ga0466715_409757 | 3300042616 | Bacteria | 45403 |
| 240 | Ga0466715_470600 | 3300042616 | Bacteria | 30941 |
| 241 | Ga0466728_060718 | 3300042620 | Bacteria | 51497 |
| 242 | Ga0466728_109744 | 3300042620 | Bacteria | 4446 |
| 243 | Ga0466728_184466 | 3300042620 | Bacteria | 6077 |
| 244 | Ga0466729_207926 | 3300042621 | Bacteria | 5996 |
| 245 | Ga0466729_252844 | 3300042621 | Bacteria | 9369 |
| 246 | Ga0466735_220264 | 3300042624 | Bacteria | 1426 |
| 247 | Ga0466730_009717 | 3300042625 | Bacteria | 11493 |
| 248 | Ga0466730_028273 | 3300042625 | Unclassified | 14364 |
| 249 | Ga0466730_036154 | 3300042625 | Unclassified | 39911 |
| 250 | Ga0466704_011447 | 3300042643 | Bacteria | 17415 |
| 251 | Ga0466704_060201 | 3300042643 | Bacteria | 120850 |
| 252 | Ga0466704_193450 | 3300042643 | Bacteria | 17342 |
| 253 | Ga0466709_011761 | 3300042648 | Bacteria | 10258 |
| 254 | Ga0466724_16719 | 3300042649 | Bacteria | 37903 |
| 255 | Ga0466706_152578 | 3300042599 | Bacteria | 3035 |
| 256 | Ga0466714_031018 | 3300042603 | Bacteria | 2054 |
| 257 | Ga0466714_102667 | 3300042603 | Unclassified | 1632 |
| 258 | Ga0466714_126192 | 3300042603 | Unclassified | 3418 |
| 259 | Ga0466716_069301 | 3300042605 | Bacteria | 13539 |
| 260 | Ga0466721_381717 | 3300042608 | Bacteria | 1357 |
| 261 | Ga0466698_016193 | 3300042610 | Bacteria | 1741 |
| 262 | 2227358559 | 2225789004 | Bacteria | 111880 |
| 263 | IMNBL1DRAFT_c0026695 | 3300000062 | Unclassified | 2187 |
| 264 | JGI24702J35022_10008070 | 3300002462 | Bacteria | 5993 |
| 265 | JGI24702J35022_10408612 | 3300002462 | Unclassified | 821 |
| 266 | JGI24699J35502_10880138 | 3300002509 | Unclassified | 1007 |
| 267 | JGI24699J35502_11134218 | 3300002509 | Bacteria | 66161 |
| 268 | Ga0072941_1684689 | 3300005201 | Bacteria | 1545 |
| 269 | Ga0105005_1105112 | 3300007505 | Unclassified | 4168 |
| 270 | Ga0123357_10003323 | 3300009784 | Bacteria | 18385 |
| 271 | Ga0466733_188861 | 3300042659 | Bacteria | 7633 |
| 272 | Ga0562374_0313 | 3300057007 | Bacteria | 91457 |
| 273 | Ga0123357_10183606 | 3300009784 | Bacteria | 2434 |
| 274 | Ga0123356_10075684 | 3300010049 | Bacteria | 3171 |
| 275 | Ga0123356_10115277 | 3300010049 | Bacteria | 2603 |
| 276 | Ga0123356_10546582 | 3300010049 | Bacteria | 1319 |
| 277 | Ga0123356_10710994 | 3300010049 | Bacteria | 1174 |
| 278 | Ga0123356_11028943 | 3300010049 | Bacteria | 993 |
| 279 | Ga0123353_10154431 | 3300010167 | Bacteria | 3661 |
| 280 | Ga0123353_10316107 | 3300010167 | Bacteria | 2373 |
| 281 | Ga0265387_1001065 | 3300024582 | Bacteria | 4081 |
| 282 | Ga0247289_0302 | 3300035363 | Unclassified | 8727 |
| 283 | Ga0466691_023996 | 3300042593 | Bacteria | 25210 |
| 284 | Ga0466691_065798 | 3300042593 | Bacteria | 9126 |
| 285 | Ga0466696_017327 | 3300042596 | Bacteria | 1058 |
| 286 | Ga0466701_014387 | 3300042598 | Bacteria | 1266 |
| 287 | Ga0466712_012980 | 3300042614 | Bacteria | 18403 |
| 288 | Ga0466711_176032 | 3300042615 | Unclassified | 1554 |
| 289 | Ga0466711_204478 | 3300042615 | Bacteria | 6552 |
| 290 | Ga0466711_210405 | 3300042615 | Unclassified | 1830 |
| 291 | Ga0466711_330432 | 3300042615 | Bacteria | 4077 |
| 292 | Ga0466711_403915 | 3300042615 | Unclassified | 1070 |
| 293 | Ga0466715_195924 | 3300042616 | Bacteria | 13914 |
| 294 | Ga0466715_237537 | 3300042616 | Bacteria | 14528 |
| 295 | Ga0466715_251858 | 3300042616 | Unclassified | 4524 |
| 296 | Ga0466731_374888 | 3300042622 | Bacteria | 2537 |
| 297 | Ga0466734_091027 | 3300042623 | Bacteria | 1848 |
| 298 | Ga0466735_008676 | 3300042624 | Bacteria | 4088 |
| 299 | Ga0466730_027937 | 3300042625 | Bacteria | 15598 |
| 300 | Ga0466709_219248 | 3300042648 | Bacteria | 5037 |
| 301 | Ga0466724_29726 | 3300042649 | Bacteria | 169575 |
| 302 | Ga0466724_64744 | 3300042649 | Unclassified | 10000 |
| 303 | Ga0466708_054367 | 3300042652 | Bacteria | 2564 |
| 304 | Ga0466706_003493 | 3300042599 | Bacteria | 4309 |
| 305 | Ga0466706_034510 | 3300042599 | Bacteria | 1970 |
| 306 | Ga0466706_142707 | 3300042599 | Bacteria | 44049 |
| 307 | Ga0466706_189473 | 3300042599 | Bacteria | 52664 |
| 308 | Ga0466700_036090 | 3300042600 | Bacteria | 3257 |
| 309 | Ga0466713_033466 | 3300042602 | Bacteria | 29048 |
| 310 | Ga0466714_011999 | 3300042603 | Bacteria | 2241 |
| 311 | Ga0466714_012327 | 3300042603 | Bacteria | 6093 |
| 312 | Ga0466714_152332 | 3300042603 | Unclassified | 1754 |
| 313 | Ga0466714_169401 | 3300042603 | Bacteria | 12708 |
| 314 | Ga0466719_046595 | 3300042606 | Bacteria | 5728 |
| 315 | Ga0466722_110344 | 3300042609 | Bacteria | 2264 |
| 316 | Ga0466722_170103 | 3300042609 | Bacteria | 5889 |
| 317 | FGTW_contig21204 | 2065487013 | Unclassified | 2404 |
| 318 | 2227476032 | 2225789004 | Bacteria | 4639 |
| 319 | JGI24702J35022_10009190 | 3300002462 | Bacteria | 5560 |
| 320 | Meta3P_1002144 | 3300002464 | Unclassified | 7619 |
| 321 | CVPL010L_1000146 | 3300002932 | Bacteria | 36041 |
| 322 | Ga0063521_1000013 | 3300003973 | Bacteria | 168262 |
| 323 | Ga0068302_10034443 | 3300005071 | Bacteria | 3917 |
| 324 | Ga0068305_10003997 | 3300005083 | Bacteria | 66958 |
| 325 | Ga0466733_028425 | 3300042659 | Bacteria | 11601 |
| 326 | Ga0466733_036102 | 3300042659 | Bacteria | 2255 |
| 327 | Ga0466733_061202 | 3300042659 | Bacteria | 9052 |
| 328 | Ga0562378_0268 | 3300056814 | Bacteria | 117448 |
| 329 | Ga0562377_0379 | 3300056842 | Unclassified | 82060 |
| 330 | Ga0123354_10036633 | 3300010882 | Bacteria | 7649 |
| 331 | Ga0123354_10199294 | 3300010882 | Bacteria | 2208 |
| 332 | Ga0415639_244012 | 3300038395 | Bacteria | 1466 |
| 333 | Ga0466690_356586 | 3300042590 | Bacteria | 2743 |
| 334 | Ga0466699_354916 | 3300042597 | Bacteria | 4885 |
| 335 | Ga0466711_086844 | 3300042615 | Bacteria | 3450 |
| 336 | Ga0466711_182605 | 3300042615 | Bacteria | 2932 |
| 337 | Ga0466715_079623 | 3300042616 | Bacteria | 36932 |
| 338 | Ga0466726_447519 | 3300042619 | Bacteria | 2956 |
| 339 | Ga0466735_028924 | 3300042624 | Bacteria | 1369 |
| 340 | Ga0466735_071139 | 3300042624 | Bacteria | 1327 |
| 341 | Ga0466730_071018 | 3300042625 | Bacteria | 3780 |
| 342 | Ga0466704_140500 | 3300042643 | Bacteria | 7703 |
| 343 | Ga0466704_211326 | 3300042643 | Bacteria | 9813 |
| 344 | Ga0466724_29348 | 3300042649 | Unclassified | 6851 |
| 345 | Ga0466708_359348 | 3300042652 | Bacteria | 27546 |
| 346 | Ga0466706_012698 | 3300042599 | Bacteria | 23344 |
| 347 | Ga0466706_018696 | 3300042599 | Bacteria | 14570 |
| 348 | Ga0466706_249136 | 3300042599 | Bacteria | 6489 |
| 349 | Ga0466707_239134 | 3300042601 | Bacteria | 5155 |
| 350 | Ga0466707_293297 | 3300042601 | Bacteria | 2237 |
| 351 | Ga0466713_086675 | 3300042602 | Bacteria | 12685 |
| 352 | Ga0466714_012201 | 3300042603 | Bacteria | 12870 |
| 353 | Ga0466714_038130 | 3300042603 | Bacteria | 1332 |
| 354 | Ga0466714_078693 | 3300042603 | Bacteria | 6685 |
| 355 | Ga0466714_084980 | 3300042603 | Bacteria | 1138 |
| 356 | DPOL_contig07412 | 2035918003 | Bacteria | 4622 |
| 357 | 2227302993 | 2225789004 | Bacteria | 29974 |
| 358 | IMNBL1DRAFT_c0002636 | 3300000062 | Bacteria | 12274 |
| 359 | JGI24702J35022_10009448 | 3300002462 | Bacteria | 5472 |
| 360 | JGI24702J35022_10180522 | 3300002462 | Bacteria | 1199 |
| 361 | Ga0068302_10252826 | 3300005071 | Bacteria | 1545 |
| 362 | Ga0068305_10400663 | 3300005083 | Bacteria | 4286 |
| 363 | Ga0105553_1033616 | 3300007767 | Bacteria | 8005 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02508 | Rnf-Nqr | Rnf-Nqr subunit, membrane protein | 27 | 218 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02508 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.