Protein Family IF10225
Metagenome
Metatranscriptome
Isolate
229
Members
96
Samples
199
Scaffolds
62.1
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_053935|Ga0466732_053935_25_252
- Length
- 75 aa
- Sequence
- MVPLQFELENIKIMAKKNKEARQQIILECTEQKTSGIAGMSRYISTKNRKNSPERLELKKYNPFLKKVTVHKEIK
Sample Types
Isolate
13.1%
Metagenome
86.5%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.8%
Unclassified
19.6%
Kalotermitidae
15.2%
Elmidae
4.3%
Rhinotermitidae
3.3%
Pseudophyllodromiidae
3.3%
Culicidae
3.3%
Formicidae
2.2%
Passalidae
2.2%
Blattidae
2.2%
Termopsidae
2.2%
Hodotermitidae
1.1%
Tryonicidae
1.1%
Daphniidae
1.1%
Aphididae
1.1%
Cambaridae
1.1%
Nephropidae
1.1%
Drosophilidae
1.1%
Taxonomy
Archaea
0
Bacteria
150
Eukaryota
0
Viruses
0
Unclassified
79
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 2 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 20 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 21 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 22 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 30 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 34 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 35 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 36 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 37 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 43 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 44 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 49 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 50 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 51 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 52 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 53 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 54 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 55 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 56 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 57 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 58 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 59 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 60 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 61 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 62 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 63 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 64 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 65 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 66 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 67 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 68 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 69 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 70 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 71 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 72 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 73 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 74 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 75 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 76 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 77 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 78 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 79 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 80 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 81 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 82 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 83 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 84 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 85 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 86 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 87 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 88 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 89 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 90 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 91 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 92 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 93 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 94 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 95 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 96 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_144690 | 3300042611 | Unclassified | 1705 |
| 2 | Ga0466732_012384 | 3300042656 | Bacteria | 6388 |
| 3 | Ga0466732_301888 | 3300042656 | Unclassified | 2903 |
| 4 | Ga0466733_096297 | 3300042659 | Unclassified | 6297 |
| 5 | Ga0466729_285140 | 3300042621 | Bacteria | 9746 |
| 6 | Ga0466731_255059 | 3300042622 | Unclassified | 3500 |
| 7 | Ga0466725_097183 | 3300042654 | Bacteria | 17786 |
| 8 | Ga0466707_376833 | 3300042601 | Bacteria | 9714 |
| 9 | Ga0466722_025381 | 3300042609 | Bacteria | 16120 |
| 10 | Ga0466711_009899 | 3300042615 | Bacteria | 28031 |
| 11 | Ga0466726_300616 | 3300042619 | Bacteria | 2863 |
| 12 | 2227465524 | 2225789004 | Unclassified | 974 |
| 13 | JGI24702J35022_10012592 | 3300002462 | Unclassified | 4696 |
| 14 | Ga0105005_1100372 | 3300007505 | Bacteria | 2255 |
| 15 | Ga0123356_10004417 | 3300010049 | Bacteria | 14534 |
| 16 | Ga0123353_10955867 | 3300010167 | Unclassified | 1158 |
| 17 | Ga0255786_1026738 | 3300022815 | Bacteria | 988 |
| 18 | Ga0466656_070045 | 3300042550 | Bacteria | 1284 |
| 19 | Ga0466690_394866 | 3300042590 | Bacteria | 116329 |
| 20 | Ga0466694_375854 | 3300042594 | Unclassified | 2126 |
| 21 | Ga0466705_045970 | 3300042612 | Bacteria | 6685 |
| 22 | Ga0466705_138505 | 3300042612 | Bacteria | 4048 |
| 23 | Ga0466729_222099 | 3300042621 | Bacteria | 9877 |
| 24 | Ga0466709_207629 | 3300042648 | Bacteria | 2798 |
| 25 | Ga0466708_170875 | 3300042652 | Bacteria | 19923 |
| 26 | Ga0466727_071315 | 3300042655 | Bacteria | 5261 |
| 27 | Ga0466706_079875 | 3300042599 | Unclassified | 1366 |
| 28 | Ga0466716_040990 | 3300042605 | Bacteria | 3678 |
| 29 | Ga0466715_523101 | 3300042616 | Bacteria | 3340 |
| 30 | Ga0466726_485687 | 3300042619 | Bacteria | 5085 |
| 31 | Ga0466729_152690 | 3300042621 | Bacteria | 1416 |
| 32 | IMNBL1DRAFT_c0037434 | 3300000062 | Bacteria | 1681 |
| 33 | IMNBL1DRAFT_c0052720 | 3300000062 | Unclassified | 1272 |
| 34 | JGI24699J35502_10433241 | 3300002509 | Bacteria | 580 |
| 35 | Ga0068305_10421606 | 3300005083 | Bacteria | 2347 |
| 36 | Ga0103264_1000031 | 3300007188 | Bacteria | 88926 |
| 37 | Ga0123355_10295375 | 3300009826 | Bacteria | 2217 |
| 38 | Ga0123356_11963125 | 3300010049 | Bacteria | 729 |
| 39 | Ga0123353_10126978 | 3300010167 | Bacteria | 4098 |
| 40 | Ga0123353_11692404 | 3300010167 | Unclassified | 793 |
| 41 | Ga0123354_10179874 | 3300010882 | Unclassified | 2420 |
| 42 | Ga0160471_122075 | 3300012812 | Bacteria | 566 |
| 43 | Ga0160459_120352 | 3300012831 | Unclassified | 713 |
| 44 | Ga0466692_191312 | 3300042591 | Bacteria | 9441 |
| 45 | Ga0466693_448766 | 3300042592 | Unclassified | 1334 |
| 46 | Ga0466733_038690 | 3300042659 | Bacteria | 100300 |
| 47 | Ga0466734_102924 | 3300042623 | Unclassified | 1978 |
| 48 | Ga0466706_121373 | 3300042599 | Bacteria | 45048 |
| 49 | Ga0466706_128660 | 3300042599 | Bacteria | 41980 |
| 50 | Ga0466700_331025 | 3300042600 | Bacteria | 1027 |
| 51 | Ga0466714_015825 | 3300042603 | Bacteria | 102725 |
| 52 | Ga0466722_174660 | 3300042609 | Bacteria | 3818 |
| 53 | Ga0466729_074859 | 3300042621 | Bacteria | 14023 |
| 54 | 2227486679 | 2225789004 | Bacteria | 815 |
| 55 | JGI24696J40584_12803151 | 3300002834 | Unclassified | 873 |
| 56 | JGI24696J40584_12951665 | 3300002834 | Unclassified | 2266 |
| 57 | Ga0072941_1315850 | 3300005201 | Bacteria | 756 |
| 58 | Ga0123356_10874694 | 3300010049 | Bacteria | 1070 |
| 59 | Ga0123356_12367605 | 3300010049 | Unclassified | 664 |
| 60 | Ga0123353_10000041 | 3300010167 | Bacteria | 137212 |
| 61 | Ga0123353_10079546 | 3300010167 | Unclassified | 5270 |
| 62 | Ga0123353_13389417 | 3300010167 | Unclassified | 506 |
| 63 | Ga0415639_136978 | 3300038395 | Unclassified | 1853 |
| 64 | Ga0466690_060977 | 3300042590 | Unclassified | 3591 |
| 65 | Ga0466690_198735 | 3300042590 | Bacteria | 14984 |
| 66 | Ga0466694_013682 | 3300042594 | Unclassified | 3150 |
| 67 | Ga0466694_215724 | 3300042594 | Unclassified | 3480 |
| 68 | Ga0466695_310116 | 3300042595 | Bacteria | 1279 |
| 69 | Ga0466699_231248 | 3300042597 | Unclassified | 1976 |
| 70 | Ga0466729_203921 | 3300042621 | Bacteria | 1355 |
| 71 | Ga0466731_094301 | 3300042622 | Bacteria | 71133 |
| 72 | Ga0466703_345312 | 3300042636 | Bacteria | 2445 |
| 73 | Ga0466709_183247 | 3300042648 | Bacteria | 3970 |
| 74 | Ga0466727_180441 | 3300042655 | Bacteria | 4321 |
| 75 | Ga0466701_066521 | 3300042598 | Bacteria | 14955 |
| 76 | Ga0466706_021441 | 3300042599 | Bacteria | 78920 |
| 77 | Ga0466700_357923 | 3300042600 | Bacteria | 6283 |
| 78 | Ga0466722_118799 | 3300042609 | Bacteria | 5856 |
| 79 | Ga0466697_032966 | 3300042611 | Bacteria | 1214 |
| 80 | Ga0466715_054005 | 3300042616 | Unclassified | 2933 |
| 81 | Ga0466715_230175 | 3300042616 | Unclassified | 1651 |
| 82 | Ga0466723_345193 | 3300042618 | Bacteria | 1990 |
| 83 | Ga0466728_182834 | 3300042620 | Unclassified | 1308 |
| 84 | 2227518832 | 2225789004 | Unclassified | 671 |
| 85 | Ga0123355_10000003 | 3300009826 | Bacteria | 224088 |
| 86 | Ga0123353_12145616 | 3300010167 | Unclassified | 678 |
| 87 | Ga0466657_259302 | 3300042582 | Bacteria | 12981 |
| 88 | Ga0466696_346629 | 3300042596 | Unclassified | 1134 |
| 89 | Ga0466732_053935 | 3300042656 | Bacteria | 1342 |
| 90 | Ga0466703_305977 | 3300042636 | Unclassified | 3419 |
| 91 | Ga0466704_461004 | 3300042643 | Bacteria | 8737 |
| 92 | Ga0466727_080573 | 3300042655 | Bacteria | 1778 |
| 93 | Ga0466706_057633 | 3300042599 | Bacteria | 4689 |
| 94 | Ga0466713_141397 | 3300042602 | Bacteria | 4712 |
| 95 | Ga0466720_212859 | 3300042607 | Unclassified | 1289 |
| 96 | Ga0466698_284397 | 3300042610 | Bacteria | 1178 |
| 97 | Ga0466715_224612 | 3300042616 | Bacteria | 7778 |
| 98 | Ga0466723_314940 | 3300042618 | Bacteria | 4877 |
| 99 | Ga0466729_116601 | 3300042621 | Bacteria | 6871 |
| 100 | Ga0466729_180507 | 3300042621 | Bacteria | 9099 |
| 101 | 2227574615 | 2225789004 | Bacteria | 13777 |
| 102 | IMNBL1DRAFT_c0011574 | 3300000062 | Bacteria | 4112 |
| 103 | JGI24695J34938_10176038 | 3300002450 | Unclassified | 884 |
| 104 | JGI24702J35022_10004789 | 3300002462 | Bacteria | 7993 |
| 105 | JGI24702J35022_10019861 | 3300002462 | Unclassified | 3653 |
| 106 | JGI24702J35022_10152817 | 3300002462 | Bacteria | 1296 |
| 107 | Ga0103267_1000282 | 3300007190 | Unclassified | 19664 |
| 108 | Ga0127649_100753 | 3300009460 | Bacteria | 72069 |
| 109 | Ga0123356_11636188 | 3300010049 | Unclassified | 798 |
| 110 | Ga0123356_13162616 | 3300010049 | Unclassified | 573 |
| 111 | Ga0123353_10168242 | 3300010167 | Unclassified | 3482 |
| 112 | Ga0123354_10471383 | 3300010882 | Bacteria | 1000 |
| 113 | Ga0466656_111342 | 3300042550 | Bacteria | 1647 |
| 114 | Ga0466692_108411 | 3300042591 | Bacteria | 15895 |
| 115 | Ga0466693_112491 | 3300042592 | Unclassified | 1395 |
| 116 | Ga0466695_160287 | 3300042595 | Unclassified | 1136 |
| 117 | Ga0466695_243041 | 3300042595 | Unclassified | 1840 |
| 118 | Ga0466699_230644 | 3300042597 | Unclassified | 2018 |
| 119 | Ga0466733_193881 | 3300042659 | Unclassified | 9464 |
| 120 | Ga0466734_049571 | 3300042623 | Unclassified | 1515 |
| 121 | Ga0466719_372678 | 3300042606 | Bacteria | 2620 |
| 122 | Ga0466721_099063 | 3300042608 | Bacteria | 1729 |
| 123 | Ga0466698_498956 | 3300042610 | Unclassified | 3339 |
| 124 | Ga0466710_358407 | 3300042613 | Bacteria | 4106 |
| 125 | Ga0466715_253205 | 3300042616 | Bacteria | 7992 |
| 126 | Ga0466729_151093 | 3300042621 | Unclassified | 1837 |
| 127 | IMNBL1DRAFT_c0044762 | 3300000062 | Bacteria | 1451 |
| 128 | JGI24695J34938_10114017 | 3300002450 | Bacteria | 1101 |
| 129 | JGI24702J35022_10000345 | 3300002462 | Bacteria | 27477 |
| 130 | JGI24696J40584_12480901 | 3300002834 | Unclassified | 590 |
| 131 | Ga0123357_10284154 | 3300009784 | Unclassified | 1703 |
| 132 | Ga0123355_11640135 | 3300009826 | Unclassified | 617 |
| 133 | Ga0123356_10294308 | 3300010049 | Unclassified | 1725 |
| 134 | Ga0123356_10431708 | 3300010049 | Bacteria | 1462 |
| 135 | Ga0123353_10714339 | 3300010167 | Unclassified | 1403 |
| 136 | Ga0160472_100005 | 3300012839 | Bacteria | 734812 |
| 137 | Ga0466692_062645 | 3300042591 | Bacteria | 1632 |
| 138 | Ga0466691_011534 | 3300042593 | Bacteria | 26579 |
| 139 | Ga0466696_415766 | 3300042596 | Unclassified | 1484 |
| 140 | Ga0466732_248632 | 3300042656 | Unclassified | 1413 |
| 141 | Ga0466733_152570 | 3300042659 | Bacteria | 60084 |
| 142 | Ga0466731_021732 | 3300042622 | Bacteria | 1039 |
| 143 | Ga0466708_131174 | 3300042652 | Bacteria | 21946 |
| 144 | Ga0466701_032206 | 3300042598 | Bacteria | 3049 |
| 145 | Ga0466701_048254 | 3300042598 | Bacteria | 1778 |
| 146 | Ga0466713_108603 | 3300042602 | Bacteria | 12563 |
| 147 | Ga0466717_173099 | 3300042604 | Unclassified | 1023 |
| 148 | Ga0466719_212331 | 3300042606 | Bacteria | 1153 |
| 149 | Ga0466722_086635 | 3300042609 | Bacteria | 4339 |
| 150 | Ga0466710_211503 | 3300042613 | Unclassified | 1038 |
| 151 | Ga0466710_378434 | 3300042613 | Unclassified | 1940 |
| 152 | Ga0466715_235999 | 3300042616 | Bacteria | 4568 |
| 153 | Ga0466728_340570 | 3300042620 | Bacteria | 1960 |
| 154 | IMNBL1DRAFT_c0042068 | 3300000062 | Unclassified | 1527 |
| 155 | IMNBL1DRAFT_c0112913 | 3300000062 | Bacteria | 720 |
| 156 | JGI24695J34938_10062722 | 3300002450 | Unclassified | 1577 |
| 157 | JGI24705J35276_12219990 | 3300002504 | Unclassified | 2238 |
| 158 | JGI24696J40584_12897152 | 3300002834 | Unclassified | 1163 |
| 159 | JGI24696J40584_12906240 | 3300002834 | Bacteria | 1220 |
| 160 | JGI24696J40584_12956663 | 3300002834 | Unclassified | 3187 |
| 161 | Ga0123357_10149746 | 3300009784 | Bacteria | 2837 |
| 162 | Ga0123355_11818724 | 3300009826 | Bacteria | 574 |
| 163 | Ga0123356_10072424 | 3300010049 | Unclassified | 3237 |
| 164 | Ga0123356_10791947 | 3300010049 | Unclassified | 1119 |
| 165 | Ga0123356_11875228 | 3300010049 | Unclassified | 746 |
| 166 | Ga0123353_10360970 | 3300010167 | Unclassified | 2183 |
| 167 | Ga0123353_10657476 | 3300010167 | Unclassified | 1482 |
| 168 | Ga0415639_127654 | 3300038395 | Unclassified | 1059 |
| 169 | Ga0466701_008346 | 3300042598 | Bacteria | 3738 |
| 170 | Ga0466697_135422 | 3300042611 | Unclassified | 2478 |
| 171 | Ga0466733_135608 | 3300042659 | Unclassified | 1594 |
| 172 | Ga0466727_025519 | 3300042655 | Bacteria | 1080 |
| 173 | Ga0466701_027187 | 3300042598 | Bacteria | 1966 |
| 174 | Ga0466701_043606 | 3300042598 | Bacteria | 24638 |
| 175 | Ga0466701_097857 | 3300042598 | Bacteria | 3598 |
| 176 | Ga0466700_308703 | 3300042600 | Bacteria | 1484 |
| 177 | Ga0466714_015759 | 3300042603 | Bacteria | 13284 |
| 178 | Ga0466721_006866 | 3300042608 | Bacteria | 1103 |
| 179 | Ga0466710_033506 | 3300042613 | Bacteria | 2617 |
| 180 | Ga0466710_180526 | 3300042613 | Unclassified | 2053 |
| 181 | Ga0466710_404631 | 3300042613 | Bacteria | 2296 |
| 182 | Ga0466711_288037 | 3300042615 | Bacteria | 4448 |
| 183 | Ga0466711_331426 | 3300042615 | Bacteria | 7251 |
| 184 | Ga0466715_018721 | 3300042616 | Bacteria | 59480 |
| 185 | Ga0466723_115921 | 3300042618 | Unclassified | 3478 |
| 186 | Ga0466723_204706 | 3300042618 | Bacteria | 1474 |
| 187 | JGI24696J40584_12908042 | 3300002834 | Unclassified | 1233 |
| 188 | Ga0123355_10002918 | 3300009826 | Bacteria | 24295 |
| 189 | Ga0123356_12065684 | 3300010049 | Unclassified | 711 |
| 190 | Ga0123353_10357296 | 3300010167 | Bacteria | 2197 |
| 191 | Ga0123353_10971459 | 3300010167 | Unclassified | 1146 |
| 192 | Ga0123353_12678180 | 3300010167 | Unclassified | 588 |
| 193 | Ga0123353_12955327 | 3300010167 | Bacteria | 552 |
| 194 | Ga0160440_118599 | 3300012815 | Unclassified | 598 |
| 195 | Ga0466657_119731 | 3300042582 | Unclassified | 1821 |
| 196 | Ga0466690_081262 | 3300042590 | Bacteria | 11472 |
| 197 | Ga0466690_130976 | 3300042590 | Bacteria | 5979 |
| 198 | Ga0466691_050111 | 3300042593 | Bacteria | 49131 |
| 199 | Ga0466696_305779 | 3300042596 | Unclassified | 1099 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00471 | Ribosomal_L33 | Ribosomal protein L33 | 24 | 75 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.