Protein Family IF10084
Metagenome
Metatranscriptome
Isolate
223
Members
85
Samples
188
Scaffolds
94.91
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_323295|Ga0466725_323295_3574_3915
- Length
- 113 aa
- Sequence
- MVSQFKEQLLKKNKGGFVMKLVPLGDKIVLKQLEAEETTKSGIVLPGQAKEKPQEAEVVAVGPGGNIEGKEIVMQVKVGEKVIYSKYAGTEVELDGEEYIIVKQSDILAIVSE
Sample Types
Isolate
15.7%
Metagenome
82.5%
MAG
0.0%
Metatranscriptome
1.8%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
40.2%
Termitidae
35.4%
Kalotermitidae
8.5%
Apidae
4.9%
Passalidae
3.7%
Termopsidae
2.4%
Rhinotermitidae
2.4%
Calliphoridae
1.2%
Hodotermitidae
1.2%
Taxonomy
Archaea
0
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
36
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 2 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 3 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 4 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 14 | 3300021220 | Termite gut microbial communities from nest from French Guiana - FG16_9_6 mRNA SA | Metatranscriptome | |
| 15 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 16 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 17 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 20 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 21 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 22 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 23 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 27 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 28 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 29 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 30 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 31 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 32 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 33 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 34 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 35 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 36 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 39 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 43 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 49 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 50 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 51 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 52 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 53 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 54 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 55 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 56 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 57 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 58 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 59 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 60 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 61 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 62 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 63 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 64 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 65 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 66 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 67 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 68 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 69 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 70 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 71 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 74 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 75 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 76 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 77 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 78 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 79 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 80 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 81 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 82 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 83 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 84 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 85 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_124559 | 3300042611 | Bacteria | 4406 |
| 2 | Ga0466697_217230 | 3300042611 | Unclassified | 1656 |
| 3 | Ga0466696_016054 | 3300042596 | Bacteria | 141586 |
| 4 | Ga0123357_10710184 | 3300009784 | Bacteria | 716 |
| 5 | Ga0123355_10000213 | 3300009826 | Bacteria | 72444 |
| 6 | Ga0123355_10032620 | 3300009826 | Bacteria | 8453 |
| 7 | Ga0123355_10050015 | 3300009826 | Bacteria | 6793 |
| 8 | Ga0123355_10103394 | 3300009826 | Bacteria | 4477 |
| 9 | Ga0123355_10602782 | 3300009826 | Unclassified | 1303 |
| 10 | Ga0123355_10903803 | 3300009826 | Bacteria | 959 |
| 11 | Ga0123356_11016076 | 3300010049 | Unclassified | 999 |
| 12 | Ga0123356_11566437 | 3300010049 | Bacteria | 815 |
| 13 | Ga0123353_10458629 | 3300010167 | Unclassified | 1874 |
| 14 | Ga0466706_026527 | 3300042599 | Bacteria | 3950 |
| 15 | Ga0466706_186702 | 3300042599 | Bacteria | 1845 |
| 16 | Ga0466713_096374 | 3300042602 | Bacteria | 152284 |
| 17 | Ga0466698_156989 | 3300042610 | Bacteria | 5946 |
| 18 | Ga0466715_090805 | 3300042616 | Bacteria | 22214 |
| 19 | 2227144730 | 2225789004 | Bacteria | 1609 |
| 20 | 2227525142 | 2225789004 | Bacteria | 650 |
| 21 | IMNBL1DRAFT_c0039602 | 3300000062 | Unclassified | 1606 |
| 22 | JGI24695J34938_10138733 | 3300002450 | Unclassified | 993 |
| 23 | JGI24703J35330_11748489 | 3300002501 | Bacteria | 17413 |
| 24 | Ga0466725_043900 | 3300042654 | Bacteria | 4938 |
| 25 | Ga0255786_1005910 | 3300022815 | Bacteria | 1003 |
| 26 | Ga0415639_063450 | 3300038395 | Bacteria | 1104 |
| 27 | Ga0466656_383913 | 3300042550 | Bacteria | 1053 |
| 28 | Ga0123355_10001835 | 3300009826 | Bacteria | 29737 |
| 29 | Ga0123355_10069110 | 3300009826 | Bacteria | 5679 |
| 30 | Ga0123355_10097625 | 3300009826 | Unclassified | 4636 |
| 31 | Ga0123355_10124273 | 3300009826 | Bacteria | 3992 |
| 32 | Ga0123355_10321806 | 3300009826 | Unclassified | 2083 |
| 33 | Ga0123355_10412552 | 3300009826 | Bacteria | 1732 |
| 34 | Ga0123355_10843101 | 3300009826 | Unclassified | 1011 |
| 35 | Ga0123355_10891661 | 3300009826 | Bacteria | 968 |
| 36 | Ga0123355_11582505 | 3300009826 | Bacteria | 633 |
| 37 | Ga0123356_11820149 | 3300010049 | Unclassified | 757 |
| 38 | Ga0123356_12858648 | 3300010049 | Bacteria | 604 |
| 39 | Ga0123353_10363338 | 3300010167 | Bacteria | 2174 |
| 40 | Ga0123353_12605687 | 3300010167 | Bacteria | 598 |
| 41 | Ga0466706_134387 | 3300042599 | Bacteria | 1289 |
| 42 | Ga0466706_176479 | 3300042599 | Bacteria | 23690 |
| 43 | Ga0466719_336472 | 3300042606 | Bacteria | 54006 |
| 44 | Ga0466722_014380 | 3300042609 | Bacteria | 1748 |
| 45 | 2227393329 | 2225789004 | Bacteria | 1083 |
| 46 | 2227455812 | 2225789004 | Bacteria | 5379 |
| 47 | 2227579626 | 2225789004 | Bacteria | 2524 |
| 48 | 2227655179 | 2225789004 | Bacteria | 10661 |
| 49 | IMNBL1DRAFT_c0080382 | 3300000062 | Bacteria | 915 |
| 50 | JGI24695J34938_10000148 | 3300002450 | Bacteria | 63850 |
| 51 | Ga0068305_10567467 | 3300005083 | Bacteria | 1292 |
| 52 | Ga0466704_146299 | 3300042643 | Bacteria | 4514 |
| 53 | Ga0466725_323295 | 3300042654 | Bacteria | 4342 |
| 54 | Ga0466693_255807 | 3300042592 | Unclassified | 2200 |
| 55 | Ga0466699_380945 | 3300042597 | Bacteria | 1590 |
| 56 | Ga0123355_10495936 | 3300009826 | Bacteria | 1510 |
| 57 | Ga0123355_10689313 | 3300009826 | Bacteria | 1177 |
| 58 | Ga0123356_11503133 | 3300010049 | Bacteria | 831 |
| 59 | Ga0123356_11565339 | 3300010049 | Unclassified | 815 |
| 60 | Ga0123356_12324319 | 3300010049 | Unclassified | 670 |
| 61 | Ga0123353_10007219 | 3300010167 | Bacteria | 14969 |
| 62 | Ga0123353_10084578 | 3300010167 | Bacteria | 5107 |
| 63 | Ga0123353_10471848 | 3300010167 | Bacteria | 1839 |
| 64 | Ga0123353_12142545 | 3300010167 | Unclassified | 679 |
| 65 | Ga0123353_12840612 | 3300010167 | Bacteria | 566 |
| 66 | Ga0123354_10975323 | 3300010882 | Bacteria | 548 |
| 67 | Ga0466706_021689 | 3300042599 | Bacteria | 12942 |
| 68 | Ga0466700_028133 | 3300042600 | Bacteria | 1275 |
| 69 | Ga0466714_068159 | 3300042603 | Bacteria | 9758 |
| 70 | 2227074964 | 2225789003 | Bacteria | 2318 |
| 71 | IMNBL1DRAFT_c0021627 | 3300000062 | Unclassified | 2569 |
| 72 | AustNasuHG_c1055914 | 3300000089 | Bacteria | 799 |
| 73 | JGI24695J34938_10080655 | 3300002450 | Bacteria | 1344 |
| 74 | Ga0466729_261077 | 3300042621 | Bacteria | 24621 |
| 75 | Ga0466725_087279 | 3300042654 | Unclassified | 3615 |
| 76 | Ga0466697_139783 | 3300042611 | Bacteria | 1170 |
| 77 | Ga0233288_1042331 | 3300022232 | Bacteria | 1049 |
| 78 | Ga0466693_063471 | 3300042592 | Unclassified | 2873 |
| 79 | Ga0466693_113265 | 3300042592 | Bacteria | 1549 |
| 80 | Ga0123357_10847437 | 3300009784 | Bacteria | 605 |
| 81 | Ga0123355_10324819 | 3300009826 | Bacteria | 2068 |
| 82 | Ga0123355_10579135 | 3300009826 | Bacteria | 1343 |
| 83 | Ga0123355_11846406 | 3300009826 | Unclassified | 568 |
| 84 | Ga0123356_11238712 | 3300010049 | Bacteria | 911 |
| 85 | Ga0123353_12680140 | 3300010167 | Bacteria | 587 |
| 86 | Ga0466713_097791 | 3300042602 | Bacteria | 32394 |
| 87 | Ga0466714_061954 | 3300042603 | Bacteria | 1064 |
| 88 | Ga0466716_490126 | 3300042605 | Bacteria | 1717 |
| 89 | 2227018992 | 2225789003 | Bacteria | 1041 |
| 90 | 2227500958 | 2225789004 | Bacteria | 742 |
| 91 | IMNBL1DRAFT_c0000066 | 3300000062 | Bacteria | 95639 |
| 92 | Ga0466735_088141 | 3300042624 | Unclassified | 1791 |
| 93 | Ga0466735_127661 | 3300042624 | Bacteria | 4644 |
| 94 | Ga0466702_112408 | 3300042635 | Bacteria | 6789 |
| 95 | Ga0466702_337582 | 3300042635 | Bacteria | 1493 |
| 96 | Ga0466724_45225 | 3300042649 | Bacteria | 2940 |
| 97 | Ga0223680_122198 | 3300021220 | Bacteria | 612 |
| 98 | Ga0466693_397821 | 3300042592 | Bacteria | 1873 |
| 99 | Ga0123357_10428314 | 3300009784 | Bacteria | 1172 |
| 100 | Ga0123357_10642283 | 3300009784 | Bacteria | 790 |
| 101 | Ga0123355_10270333 | 3300009826 | Unclassified | 2363 |
| 102 | Ga0123355_10356900 | 3300009826 | Bacteria | 1930 |
| 103 | Ga0123355_10899990 | 3300009826 | Bacteria | 962 |
| 104 | Ga0123355_11426025 | 3300009826 | Bacteria | 682 |
| 105 | Ga0123355_11757103 | 3300009826 | Unclassified | 588 |
| 106 | Ga0123356_10199993 | 3300010049 | Bacteria | 2037 |
| 107 | Ga0123356_10943726 | 3300010049 | Bacteria | 1034 |
| 108 | Ga0123353_10006506 | 3300010167 | Bacteria | 15564 |
| 109 | Ga0123353_10006522 | 3300010167 | Bacteria | 15545 |
| 110 | Ga0466706_040045 | 3300042599 | Bacteria | 42290 |
| 111 | Ga0466706_108218 | 3300042599 | Bacteria | 67960 |
| 112 | Ga0466722_178764 | 3300042609 | Bacteria | 4940 |
| 113 | Ga0466715_032155 | 3300042616 | Bacteria | 207155 |
| 114 | 2227051202 | 2225789003 | Bacteria | 794 |
| 115 | 2227552466 | 2225789004 | Bacteria | 576 |
| 116 | IMNBL1DRAFT_c0002223 | 3300000062 | Bacteria | 13688 |
| 117 | JGI24703J35330_11748656 | 3300002501 | Bacteria | 23781 |
| 118 | Ga0466734_143716 | 3300042623 | Unclassified | 1848 |
| 119 | Ga0466703_384484 | 3300042636 | Bacteria | 5857 |
| 120 | Ga0466725_441241 | 3300042654 | Unclassified | 1032 |
| 121 | Ga0466705_175085 | 3300042612 | Bacteria | 17105 |
| 122 | Ga0223674_1003417 | 3300021235 | Unclassified | 1051 |
| 123 | Ga0466696_135553 | 3300042596 | Bacteria | 3364 |
| 124 | Ga0123357_10634928 | 3300009784 | Unclassified | 799 |
| 125 | Ga0123355_10054125 | 3300009826 | Bacteria | 6504 |
| 126 | Ga0123355_11288352 | 3300009826 | Bacteria | 735 |
| 127 | Ga0123353_10229503 | 3300010167 | Unclassified | 2896 |
| 128 | Ga0123353_10285041 | 3300010167 | Bacteria | 2534 |
| 129 | Ga0123353_10655064 | 3300010167 | Bacteria | 1486 |
| 130 | Ga0123353_11792822 | 3300010167 | Bacteria | 763 |
| 131 | Ga0123353_12062839 | 3300010167 | Bacteria | 696 |
| 132 | Ga0466714_019686 | 3300042603 | Bacteria | 18964 |
| 133 | Ga0466721_275466 | 3300042608 | Bacteria | 134922 |
| 134 | Ga0466722_124096 | 3300042609 | Bacteria | 4021 |
| 135 | 2227075220 | 2225789003 | Unclassified | 11395 |
| 136 | 2227406096 | 2225789004 | Bacteria | 1066 |
| 137 | 2227518467 | 2225789004 | Bacteria | 672 |
| 138 | IMNBL1DRAFT_c0054783 | 3300000062 | Bacteria | 1233 |
| 139 | JGI24702J35022_11003298 | 3300002462 | Bacteria | 519 |
| 140 | JGI24703J35330_11089443 | 3300002501 | Bacteria | 684 |
| 141 | JGI24703J35330_11748541 | 3300002501 | Bacteria | 19204 |
| 142 | JGI24697J35500_11268171 | 3300002507 | Bacteria | 3767 |
| 143 | Ga0466731_310993 | 3300042622 | Bacteria | 1947 |
| 144 | Ga0466735_069204 | 3300042624 | Bacteria | 1194 |
| 145 | Ga0466725_137711 | 3300042654 | Unclassified | 1673 |
| 146 | Ga0466727_081813 | 3300042655 | Bacteria | 6059 |
| 147 | Ga0123357_10196402 | 3300009784 | Bacteria | 2310 |
| 148 | Ga0123357_10688620 | 3300009784 | Bacteria | 738 |
| 149 | Ga0123355_10002192 | 3300009826 | Bacteria | 27553 |
| 150 | Ga0123355_10779161 | 3300009826 | Bacteria | 1073 |
| 151 | Ga0123355_10854533 | 3300009826 | Unclassified | 1000 |
| 152 | Ga0123356_11134959 | 3300010049 | Unclassified | 949 |
| 153 | Ga0123353_10007126 | 3300010167 | Bacteria | 15052 |
| 154 | Ga0123353_10090928 | 3300010167 | Unclassified | 4915 |
| 155 | Ga0123353_10117466 | 3300010167 | Bacteria | 4279 |
| 156 | Ga0123353_10750686 | 3300010167 | Bacteria | 1358 |
| 157 | Ga0123353_11840317 | 3300010167 | Unclassified | 750 |
| 158 | Ga0123353_12026211 | 3300010167 | Unclassified | 704 |
| 159 | Ga0466701_087086 | 3300042598 | Bacteria | 1581 |
| 160 | Ga0466707_361867 | 3300042601 | Bacteria | 3519 |
| 161 | Ga0466722_025300 | 3300042609 | Bacteria | 31126 |
| 162 | Ga0466722_264765 | 3300042609 | Bacteria | 1045 |
| 163 | Ga0466718_098288 | 3300042617 | Unclassified | 1452 |
| 164 | 2227386342 | 2225789004 | Bacteria | 27546 |
| 165 | 2227507950 | 2225789004 | Bacteria | 69912 |
| 166 | IMNBL1DRAFT_c0000356 | 3300000062 | Bacteria | 38730 |
| 167 | IMNBL1DRAFT_c0000611 | 3300000062 | Bacteria | 28616 |
| 168 | JGI24695J34938_10000246 | 3300002450 | Bacteria | 52162 |
| 169 | JGI24695J34938_10584536 | 3300002450 | Bacteria | 519 |
| 170 | Ga0068305_10025074 | 3300005083 | Bacteria | 1292 |
| 171 | Ga0466703_194563 | 3300042636 | Bacteria | 3766 |
| 172 | Ga0466732_055463 | 3300042656 | Bacteria | 1566 |
| 173 | Ga0123355_10009139 | 3300009826 | Bacteria | 15034 |
| 174 | Ga0123355_10019470 | 3300009826 | Bacteria | 10809 |
| 175 | Ga0123355_10023299 | 3300009826 | Bacteria | 9942 |
| 176 | Ga0123355_10838904 | 3300009826 | Bacteria | 1014 |
| 177 | Ga0123353_10901536 | 3300010167 | Bacteria | 1204 |
| 178 | Ga0123353_11270210 | 3300010167 | Bacteria | 959 |
| 179 | Ga0123353_12508046 | 3300010167 | Unclassified | 613 |
| 180 | Ga0466707_028099 | 3300042601 | Bacteria | 1305 |
| 181 | Ga0466707_240971 | 3300042601 | Bacteria | 1250 |
| 182 | Ga0466719_106826 | 3300042606 | Bacteria | 2853 |
| 183 | Ga0466698_001569 | 3300042610 | Bacteria | 30747 |
| 184 | 2227535732 | 2225789004 | Bacteria | 57093 |
| 185 | IMNBL1DRAFT_c0001461 | 3300000062 | Bacteria | 17666 |
| 186 | IMNBL1DRAFT_c0002225 | 3300000062 | Bacteria | 13680 |
| 187 | IMNBL1DRAFT_c0016674 | 3300000062 | Unclassified | 3132 |
| 188 | Ga0072941_1000820 | 3300005201 | Bacteria | 119098 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00166 | Cpn10 | Chaperonin 10 Kd subunit | 20 | 111 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.