Protein Family IF09901

Metagenome Isolate
260 Members
148 Samples
184 Scaffolds
441.95 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_130429|Ga0466708_130429_18982_20409
Length
475 aa
Sequence
LLRKTRLRAAAQPATPPGRAESTFAHANEKAQAMSSMTPQEIVSELDRHIVGQQEAKRAVAIALRNRWRRQQVDEKLRPEITPKNILMIGPTGVGKTEIARRLAQLAGAPFIKVEATKFTEVGYVGKDVDSIIRDLADLAIKQTREQEMKKHRTRAEDLAEERVLDALIPQPRLADGASDGAARQSFRKKLREGQLGDKEIELELMQPAPTLEVMSPPGMEEMAEQLKNMIGSMGAGRRKQRRLKISEAMKLLIDEEAAKLLNEDDVRAQAIQNLEQNGIVFIDEIDKVATRGGEGXXXSSAEISRQGVQRDLLPLVEGTTVSTKYGMVRTDHVLFIASGAFHLAKPSDLIPELQGRLPIRVELASLSIEDFKAILTQTHASLVRQYQALLATEGVNLEFTDDGVARIAEIACAVNEKTENIGARRLATVMERLLDEVSFDAAHLQDKNVRIDAAYVDQRLGALSQDEDLSRYIL

📊 Sample Types

Isolate 29.2%
Metagenome 70.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 20.8%
Termitidae 16.7%
Drosophilidae 13.9%
Formicidae 9.7%
Kalotermitidae 9.0%
Culicidae 6.2%
Elmidae 5.6%
Apidae 2.8%
Rhinotermitidae 2.1%
Pulicidae 1.4%
Pteromalidae 1.4%
Psyllidae 1.4%
Armadillidiidae 1.4%
Termopsidae 1.4%
Delphacidae 0.7%
Hodotermitidae 0.7%
Cixiidae 0.7%
Aphididae 0.7%
Cimicidae 0.7%
Silvanidae 0.7%
Passalidae 0.7%
Carposinidae 0.7%
Alydidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 216
Eukaryota 0
Viruses 0
Unclassified 44

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
2 2820146621 Unclassified Proteobacteria Emb289P3bin103 Isolate Unclassified
3 2517572215 Wolbachia endosymbiont of Drosophila suzukii wSuzi Isolate Drosophilidae
4 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
5 2848715743 Wolbachia endosymbiont of Drosophila ananassae wAna_Indonesia Isolate Drosophilidae
6 2884843004 Wolbachia endosymbiont of Ctenocephalides felis wCfeT Isolate Pulicidae
7 2854540230 Acetobacter sp. DsW_063 Isolate Drosophilidae
8 2896279687 Wolbachia endosymbiont of Cardiocondyla obscurior wCobs-BR2009-alpha Isolate Formicidae
9 3002394112 Gluconobacter sp. Gdi Isolate Drosophilidae
10 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 639279308 Ehrlichia ruminantium Welgevonden, ARC-OVI Isolate Unclassified
17 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
18 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
19 2513237282 Wolbachia endosymbiont wVitB of Nasonia vitripennis Isolate Pteromalidae
20 2513237393 Gluconobacter morbifer G707 Isolate Drosophilidae
21 2540341171 Wolbachia endosymbiont of Drosophila simulans wHa Isolate Drosophilidae
22 2547132200 Wolbachia sp (Diaphorina citri) Isolate Psyllidae
23 2619619280 Wolbachia pipientis wAu Isolate Drosophilidae
24 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
25 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
26 2588253760 Wolbachia endosymbiont wPip_Mol of Culex molestus Isolate Culicidae
27 2963630348 Burkholderiales bacterium 3487_49 Isolate Formicidae
28 2896342394 Wolbachia endosymbiont of Nilaparvata lugens wLug Isolate Delphacidae
29 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
32 637000340 Wolbachia endosymbiont TRS of Brugia malayi Isolate Unclassified
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
35 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
36 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
37 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
38 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
39 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
42 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
43 2841175817 Komagataeibacter saccharivorans JH1 Isolate Unclassified
44 2845997892 Wolbachia sp. wMel_AMD Isolate Drosophilidae
45 2846028689 Wolbachia endosymbiont of Nomada panzeri wNpa Isolate Apidae
46 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
47 2864791955 Aeromonas veronii S00030 Isolate Elmidae
48 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
49 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
50 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
51 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
52 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
53 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
54 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
55 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
56 638341232 Wolbachia endosymbiont of Drosophila ananassae Isolate Drosophilidae
57 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
58 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
59 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
60 2820059968 Unclassified Proteobacteria Nt197P4bin23 Isolate Unclassified
61 2744054723 Ehrlichia ruminantium Palm River Isolate Unclassified
62 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
63 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
64 3300002732 Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs Metagenome
65 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
66 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
67 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
68 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
69 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
70 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
71 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
72 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
73 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
74 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
75 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
76 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
77 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
78 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
79 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
80 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
81 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
82 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
83 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
84 2603880165 Burkholderiales A1 Isolate Unclassified
85 2603880170 Burkholderiales A2 Isolate Unclassified
86 2617270844 Dyella sp. HyOG Isolate Cixiidae
87 2820189034 Unclassified Planctomycetes Emb289P4bin17 Isolate Unclassified
88 2568526663 Wolbachia pipientis wMelPop Isolate Drosophilidae
89 2834038347 Gluconobacter sp. DsW_058 Isolate Drosophilidae
90 2840666718 Wolbachia pipientis wAlbB Isolate Culicidae
91 2843484624 Wolbachia endosymbiont of Nomada ferruginata wNfe Isolate Apidae
92 2845988041 Wolbachia sp. wRi Isolate Drosophilidae
93 2845999109 Wolbachia endosymbiont of Nomada flava wNfla Isolate Apidae
94 2846015620 Wolbachia sp. wMel_KL Isolate Drosophilidae
95 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
96 3002821025 Wolbachia endosymbiont of Pentalonia nigronervosa WolPenNig Isolate Aphididae
97 3002825763 Candidatus Wolbachia massiliensis PL13 Isolate Cimicidae
98 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
99 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
100 2993991113 Shikimatogenerans silvanidophilus JKI-2014 Isolate Silvanidae
101 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
102 642555168 Wolbachia endosymbiont of Culex quinquefasciatus Pel Isolate Culicidae
103 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
104 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
105 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
106 2513237285 Wolbachia pipientis wAlbB Isolate Culicidae
107 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
108 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
109 2820193510 Unclassified Planctomycetes Emb289P3bin83 Isolate Unclassified
110 2636416119 Wolbachia endosymbiont of Drosophila simulans Isolate Drosophilidae
111 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
112 2884844624 Wolbachia endosymbiont of Ctenocephalides felis wCfeJ Isolate Pulicidae
113 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
114 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
115 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
116 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
117 3300028910 Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 Metagenome Formicidae
118 639279309 Ehrlichia ruminantium Welgevonden, CIRAD Isolate Unclassified
119 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
120 2209111014 Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP Metagenome Psyllidae
121 2721755752 Wolbachia endosymbiont of Drosophila incompta wInc_Cu Isolate Drosophilidae
122 2834326310 Wolbachia endosymbiont of Drosophila ananassae wAna_India Isolate Drosophilidae
123 2838140227 Dyella sp. OAE510 Isolate Unclassified
124 2840963544 Wolbachia endosymbiont of Nomada leucophthalma wNleu Isolate Apidae
125 2864777284 Aeromonas hydrophila S00023 Isolate Elmidae
126 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
127 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
128 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
129 3300029809 Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 Metagenome Formicidae
130 642979308 Wolbachia endosymbiont of Culex quinquefasciatus JHB Isolate Culicidae
131 643692055 Wolbachia sp. wRi Isolate Drosophilidae
132 643886011 Wolbachia sp. wUni (Muscidifurax uniraptor) Isolate Pteromalidae
133 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
134 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
135 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
136 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
137 8116947750 Gluconacetobacter sacchari DSM 12717 Isolate Unclassified
138 2540341172 Wolbachia endosymbiont of Drosophila simulans wNo Isolate Drosophilidae
139 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
140 2820148564 Unclassified Proteobacteria Emb289P1bin36 Isolate Unclassified
141 2843491798 Wolbachia endosymbiont of Drosophila ananassae wAna_Hawaii Isolate Drosophilidae
142 2884841417 Wolbachia endosymbiont of Carposina sasakii wCauA Isolate Carposinidae
143 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
144 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
145 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
146 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
147 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
148 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10046087 3300010167 Bacteria 6924
2 Ga0466710_436565 3300042613 Bacteria 28561
3 Ga0466710_446370 3300042613 Bacteria 2548
4 Ga0466711_502593 3300042615 Bacteria 5249
5 Ga0466723_087960 3300042618 Unclassified 4574
6 Ga0466723_369063 3300042618 Bacteria 6199
7 Ga0466729_109686 3300042621 Bacteria 28411
8 Ga0160467_100119 3300012829 Bacteria 111101
9 Ga0466656_024038 3300042550 Unclassified 14808
10 Ga0466657_347384 3300042582 Bacteria 1869
11 Ga0466691_188266 3300042593 Bacteria 17944
12 Ga0466701_039976 3300042598 Bacteria 327114
13 Ga0466706_022719 3300042599 Bacteria 6904
14 Ga0466716_477318 3300042605 Bacteria 4864
15 Ga0466719_014346 3300042606 Bacteria 7505
16 Ga0466719_230899 3300042606 Bacteria 11173
17 CVPL010W_10006681 3300002931 Bacteria 11694
18 Ga0466729_294384 3300042621 Bacteria 3535
19 Ga0466731_139671 3300042622 Bacteria 6440
20 Ga0466734_108500 3300042623 Bacteria 10383
21 Ga0466735_062511 3300042624 Bacteria 6074
22 Ga0466704_531803 3300042643 Bacteria 1837
23 Ga0466708_051597 3300042652 Unclassified 6562
24 Ga0466725_037401 3300042654 Bacteria 5725
25 Ga0466725_452720 3300042654 Bacteria 10466
26 Ga0123356_10053730 3300010049 Unclassified 3750
27 Ga0123354_10000389 3300010882 Unclassified 42155
28 Ga0466715_001823 3300042616 Unclassified 19038
29 Ga0466723_087978 3300042618 Bacteria 4383
30 Ga0466695_092957 3300042595 Bacteria 11629
31 Ga0466701_011467 3300042598 Bacteria 66061
32 Ga0466701_026230 3300042598 Bacteria 150849
33 Ga0466698_036085 3300042610 Unclassified 7342
34 CVPL005W_1000371 3300002934 Unclassified 18994
35 CVPL005L_10001627 3300002938 Bacteria 39976
36 Ga0068305_10214214 3300005083 Bacteria 4014
37 Ga0102736_1004209 3300007052 Unclassified 1968
38 Ga0102734_1005580 3300007129 Bacteria 2807
39 Ga0102738_1000267 3300007141 Bacteria 10202
40 Ga0127649_123845 3300009460 Unclassified 13918
41 Ga0466730_030910 3300042625 Bacteria 6607
42 Ga0466730_064277 3300042625 Bacteria 203805
43 Ga0466704_295382 3300042643 Unclassified 3031
44 Ga0466724_60078 3300042649 Unclassified 5223
45 Ga0466725_069174 3300042654 Bacteria 4695
46 Ga0466705_168310 3300042612 Unclassified 2399
47 Ga0123357_10113670 3300009784 Bacteria 3440
48 Ga0123355_10141806 3300009826 Bacteria 3675
49 Ga0123353_10090450 3300010167 Bacteria 4929
50 Ga0123354_10140541 3300010882 Unclassified 2990
51 Ga0466728_114459 3300042620 Bacteria 18765
52 Ga0466657_147289 3300042582 Bacteria 48033
53 Ga0466690_122088 3300042590 Bacteria 4493
54 Ga0466692_189017 3300042591 Bacteria 12325
55 Ga0466691_101857 3300042593 Unclassified 1921
56 Ga0466707_034033 3300042601 Bacteria 21912
57 Ga0466719_427289 3300042606 Bacteria 52636
58 Ga0466721_387951 3300042608 Unclassified 4261
59 2218084987 2209111014 Bacteria 68114
60 JGI24702J35022_10000186 3300002462 Bacteria 33189
61 CVPL010W_10003165 3300002931 Unclassified 21331
62 Ga0102737_1001855 3300007142 Bacteria 5578
63 Ga0103264_1000012 3300007188 Bacteria 124297
64 Ga0103264_1000085 3300007188 Bacteria 60514
65 Ga0103264_1000729 3300007188 Bacteria 15497
66 Ga0466731_357514 3300042622 Unclassified 15512
67 Ga0466734_009803 3300042623 Bacteria 5748
68 Ga0466703_003338 3300042636 Bacteria 175525
69 Ga0466709_372332 3300042648 Unclassified 15272
70 Ga0466727_157864 3300042655 Bacteria 23797
71 Ga0466727_250846 3300042655 Bacteria 9319
72 Ga0466697_135841 3300042611 Bacteria 2997
73 Ga0123357_10102677 3300009784 Unclassified 3680
74 Ga0123356_10061419 3300010049 Bacteria 3509
75 Ga0123353_10045408 3300010167 Unclassified 6971
76 Ga0123354_10007831 3300010882 Bacteria 16176
77 Ga0160471_100072 3300012812 Unclassified 89657
78 Ga0466710_001748 3300042613 Bacteria 32356
79 Ga0466715_056881 3300042616 Bacteria 19859
80 Ga0466715_378042 3300042616 Bacteria 32504
81 Ga0309903_100036 3300029809 Unclassified 6920
82 Ga0466657_070885 3300042582 Bacteria 103407
83 Ga0466691_101654 3300042593 Bacteria 11482
84 Ga0466707_237744 3300042601 Bacteria 15150
85 Ga0466716_107189 3300042605 Bacteria 11471
86 Ga0466719_540828 3300042606 Bacteria 3666
87 Ga0466722_132817 3300042609 Bacteria 7420
88 IMNBL1DRAFT_c0004545 3300000062 Bacteria 8292
89 JGI24705J35276_12238703 3300002504 Bacteria 39951
90 WW0001_100254 3300002732 Bacteria 17581
91 Ga0102735_1000556 3300007080 Unclassified 7572
92 Ga0102740_1000994 3300007140 Unclassified 7563
93 Ga0102737_1001993 3300007142 Bacteria 5288
94 Ga0103264_1000527 3300007188 Bacteria 24761
95 Ga0104147_1006364 3300007224 Bacteria 35865
96 Ga0466731_157955 3300042622 Bacteria 8262
97 Ga0466730_047282 3300042625 Bacteria 2597
98 Ga0466703_194713 3300042636 Bacteria 6819
99 Ga0466704_443834 3300042643 Bacteria 10877
100 Ga0466708_135925 3300042652 Bacteria 37837
101 Ga0466725_109824 3300042654 Bacteria 4341
102 Ga0466727_142994 3300042655 Bacteria 1529
103 Ga0123355_10073680 3300009826 Unclassified 5471
104 Ga0123356_10080683 3300010049 Bacteria 3076
105 Ga0466715_024258 3300042616 Unclassified 4570
106 Ga0466715_340039 3300042616 Bacteria 7978
107 Ga0466728_359148 3300042620 Unclassified 4379
108 Ga0466690_142441 3300042590 Bacteria 2512
109 Ga0466690_277140 3300042590 Bacteria 18089
110 Ga0466701_028824 3300042598 Bacteria 1770
111 Ga0466716_011417 3300042605 Bacteria 34761
112 Ga0127656_102610 3300009453 Bacteria 11710
113 Ga0466730_043743 3300042625 Bacteria 9919
114 Ga0466709_403462 3300042648 Bacteria 10082
115 Ga0466724_05623 3300042649 Unclassified 1602
116 Ga0123356_10045276 3300010049 Unclassified 4094
117 Ga0160459_100588 3300012831 Unclassified 13263
118 Ga0160443_104206 3300012848 Bacteria 2225
119 Ga0466693_006785 3300042592 Bacteria 1516
120 Ga0466691_100773 3300042593 Bacteria 34233
121 Ga0466713_010117 3300042602 Bacteria 24141
122 Ga0466716_315630 3300042605 Bacteria 30831
123 Ga0466719_062489 3300042606 Bacteria 4305
124 CVPL010W_10000454 3300002931 Bacteria 42797
125 CVPL005W_1000108 3300002934 Unclassified 34938
126 CVPL005W_1000808 3300002934 Unclassified 10542
127 CVPL005L_10001334 3300002938 Bacteria 28420
128 Ga0072941_1073353 3300005201 Bacteria 4985
129 Ga0104050_1000269 3300007153 Bacteria 16924
130 Ga0103264_1000032 3300007188 Bacteria 148835
131 Ga0103264_1000860 3300007188 Bacteria 17626
132 Ga0123357_10000016 3300009784 Bacteria 146511
133 Ga0466703_051988 3300042636 Bacteria 2313
134 Ga0466704_061300 3300042643 Bacteria 59338
135 Ga0466704_107855 3300042643 Unclassified 20927
136 Ga0466704_444442 3300042643 Bacteria 78967
137 Ga0466704_516229 3300042643 Bacteria 12138
138 Ga0466725_222889 3300042654 Bacteria 6890
139 Ga0466733_185417 3300042659 Bacteria 37806
140 Ga0466723_024489 3300042618 Bacteria 29623
141 Ga0466728_250551 3300042620 Bacteria 5045
142 Ga0160472_100708 3300012839 Bacteria 15698
143 Ga0160447_100860 3300012849 Bacteria 12993
144 Ga0466656_064900 3300042550 Bacteria 1541
145 Ga0466657_056541 3300042582 Bacteria 144917
146 Ga0466657_281335 3300042582 Bacteria 2787
147 Ga0466690_048983 3300042590 Bacteria 2589
148 Ga0466690_255335 3300042590 Bacteria 4678
149 Ga0466701_080810 3300042598 Unclassified 2315
150 Ga0466706_108103 3300042599 Bacteria 5411
151 Ga0466719_001615 3300042606 Unclassified 5669
152 Ga0102737_1000327 3300007142 Unclassified 16230
153 Ga0103264_1000241 3300007188 Bacteria 33454
154 Ga0466731_036213 3300042622 Bacteria 13986
155 Ga0466703_207993 3300042636 Bacteria 14216
156 Ga0466709_123452 3300042648 Bacteria 22742
157 Ga0466708_384532 3300042652 Bacteria 2733
158 Ga0466725_131078 3300042654 Bacteria 16795
159 Ga0466705_006413 3300042612 Bacteria 39277
160 Ga0123355_10083353 3300009826 Bacteria 5096
161 Ga0123354_10000618 3300010882 Bacteria 37182
162 Ga0123354_10023985 3300010882 Bacteria 9624
163 Ga0466710_235629 3300042613 Bacteria 11828
164 Ga0466710_328451 3300042613 Bacteria 35241
165 Ga0309902_000026 3300028910 Unclassified 12851
166 Ga0466657_037723 3300042582 Bacteria 15201
167 Ga0466690_075561 3300042590 Bacteria 15327
168 Ga0466691_126700 3300042593 Bacteria 4773
169 Ga0466691_174247 3300042593 Bacteria 67252
170 Ga0466695_162929 3300042595 Unclassified 5785
171 Ga0466701_095031 3300042598 Bacteria 9123
172 Ga0466707_038566 3300042601 Bacteria 13336
173 Ga0466713_130829 3300042602 Bacteria 17811
174 Ga0466717_058505 3300042604 Bacteria 5583
175 Ga0466719_190476 3300042606 Bacteria 6921
176 Ga0466719_260531 3300042606 Unclassified 5498
177 JGI24695J34938_10003381 3300002450 Unclassified 11207
178 Ga0102740_1002104 3300007140 Unclassified 7998
179 Ga0466704_385797 3300042643 Bacteria 8229
180 Ga0466709_378423 3300042648 Bacteria 8228
181 Ga0466708_130429 3300042652 Bacteria 31456
182 Ga0466708_173429 3300042652 Bacteria 11050
183 Ga0466708_185351 3300042652 Unclassified 7214
184 Ga0466725_040162 3300042654 Unclassified 17661

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07724 AAA_2 AAA domain (Cdc48 subfamily) 212 361 0.95
PF07728 AAA_5 AAA domain (dynein-related subfamily) 85 121 0.94
PF00004 AAA ATPase family associated with various cellular activities (AAA) 270 364 0.82
PF00493 MCM MCM P-loop domain 37 108 0.81

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.