Protein Family IF09798
Metagenome
Isolate
166
Members
113
Samples
109
Scaffolds
433.01
Avg Length
Representative Sequence
- ID
- 3300042649|Ga0466724_56971|Ga0466724_56971_1352_2776
- Length
- 474 aa
- Sequence
- MTSSPSAAFAAHLIDVHGSADAQPVPEPHLQPLQFLQHLYRVAVRDALPLEGLRKHLPAAPKGRTLVIGAGKAGAAMAQAMEQLWPLDAPLSGLVVTRYGHIPPRPPGLARRIEVVEAAHPVPDAAGLLAAERMLALTEGLSADDLVVCLISGGGSALLTLPAEGLSLADKQRINRELLESGAHIGEMNCVRKHLSRIKGGRLGAACHPAQVVSLLISDVPGDSPAIIASGPTVPDPSSCADALAILERYAIAIPEPVRAALHSGALETPKPGDPRFAGHQVQLIATPQQSLQAAAAAARDAGIACHVLSDEIEGESREVAKVHAALARAVALHGQPFSRPCVILSGGETTVTLRKPAEGAARGRGGRAGEFCLGLAQALQAMPGVWALAADTDGIDGVEDNAGAVVTPDTLARAAALQLKPAAYQDRNDSYGFFGPLGDLVVTGPTHTNVNDFRALLILQPMDAPMKKAASSG
Sample Types
Isolate
34.3%
Metagenome
65.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Formicidae
14.3%
Coreidae
13.3%
Termitidae
12.4%
Elmidae
10.5%
Culicidae
10.5%
Unclassified
10.5%
Curculionidae
10.5%
Kalotermitidae
4.8%
Armadillidiidae
4.8%
Hydrophilidae
1.9%
Trigoniulidae
1.0%
Termopsidae
1.0%
Drosophilidae
1.0%
Hodotermitidae
1.0%
Passalidae
1.0%
Alydidae
1.0%
Kiwaidae
1.0%
Taxonomy
Archaea
0
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 2 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 3 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 4 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 9 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 10 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 11 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 12 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 13 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 14 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 15 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 16 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 17 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 18 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 19 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 20 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 21 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 22 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 23 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 24 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 25 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 26 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 27 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 28 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 29 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 30 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 31 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 32 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 35 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 36 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 37 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 38 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 39 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 40 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 41 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 42 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 43 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 44 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 45 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 46 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 47 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 48 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 49 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 50 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 51 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 52 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 53 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 54 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 55 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 56 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 57 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 58 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 59 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 60 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 61 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 62 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 63 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 64 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 65 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 66 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 67 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 68 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 69 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 70 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 71 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 72 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 73 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 74 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 75 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 76 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 77 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 78 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 79 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 80 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 81 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 82 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 83 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 84 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 85 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 86 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 87 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 88 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 89 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 90 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 91 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 92 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 93 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 94 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 95 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 96 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 97 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 98 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 99 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 100 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 101 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 102 | 2820148564 | Unclassified Proteobacteria Emb289P1bin36 | Isolate | Unclassified |
| 103 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 104 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 105 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 106 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 107 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 108 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 109 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 110 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 111 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 112 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 113 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160467_101695 | 3300012829 | Unclassified | 7266 |
| 2 | Ga0160460_101501 | 3300012845 | Unclassified | 7613 |
| 3 | Ga0160435_1005122 | 3300012857 | Unclassified | 2995 |
| 4 | Ga0123355_10067104 | 3300009826 | Bacteria | 5774 |
| 5 | Ga0123356_10033564 | 3300010049 | Unclassified | 4799 |
| 6 | SPBB_contig00067 | 2044078006 | Bacteria | 90332 |
| 7 | Ga0103260_1000046 | 3300007139 | Bacteria | 36821 |
| 8 | Ga0102738_1000259 | 3300007141 | Bacteria | 10492 |
| 9 | Ga0466724_13715 | 3300042649 | Bacteria | 51736 |
| 10 | Ga0466724_14853 | 3300042649 | Bacteria | 20843 |
| 11 | Ga0466724_42462 | 3300042649 | Bacteria | 351483 |
| 12 | Ga0160470_103376 | 3300012813 | Unclassified | 2596 |
| 13 | Ga0160460_100307 | 3300012845 | Bacteria | 36044 |
| 14 | Ga0160433_100082 | 3300012846 | Bacteria | 100015 |
| 15 | Ga0157631_138358 | 3300013007 | Bacteria | 7844 |
| 16 | Ga0316159_10300 | 3300030930 | Bacteria | 13506 |
| 17 | Ga0466693_252764 | 3300042592 | Bacteria | 2018 |
| 18 | Ga0160465_104732 | 3300012803 | Bacteria | 1982 |
| 19 | Ga0466710_457839 | 3300042613 | Bacteria | 13879 |
| 20 | SPBB_contig11573 | 2044078006 | Bacteria | 32242 |
| 21 | CVPL010W_10000214 | 3300002931 | Unclassified | 52916 |
| 22 | Ga0103263_100052 | 3300007042 | Bacteria | 26688 |
| 23 | Ga0102734_1000114 | 3300007129 | Bacteria | 26508 |
| 24 | Ga0102740_1000021 | 3300007140 | Bacteria | 55729 |
| 25 | Ga0103268_1000179 | 3300007192 | Unclassified | 35156 |
| 26 | Ga0466724_26494 | 3300042649 | Bacteria | 236200 |
| 27 | Ga0160470_100856 | 3300012813 | Unclassified | 9050 |
| 28 | Ga0160459_100018 | 3300012831 | Bacteria | 386190 |
| 29 | Ga0160446_100734 | 3300012835 | Unclassified | 10569 |
| 30 | Ga0160472_100918 | 3300012839 | Unclassified | 11365 |
| 31 | Ga0160460_105435 | 3300012845 | Bacteria | 1831 |
| 32 | Ga0160443_101541 | 3300012848 | Unclassified | 7383 |
| 33 | Ga0466696_496433 | 3300042596 | Bacteria | 7289 |
| 34 | Ga0123356_10028490 | 3300010049 | Bacteria | 5233 |
| 35 | Ga0160465_100683 | 3300012803 | Unclassified | 13467 |
| 36 | Ga0160442_103739 | 3300012806 | Unclassified | 1583 |
| 37 | Ga0102739_1000041 | 3300007095 | Bacteria | 36435 |
| 38 | Ga0102740_1000721 | 3300007140 | Bacteria | 8940 |
| 39 | Ga0466724_25374 | 3300042649 | Bacteria | 80841 |
| 40 | Ga0466706_066430 | 3300042599 | Bacteria | 19494 |
| 41 | Ga0160452_101467 | 3300012834 | Bacteria | 6709 |
| 42 | Ga0160446_103711 | 3300012835 | Bacteria | 2364 |
| 43 | Ga0160447_102122 | 3300012849 | Unclassified | 7200 |
| 44 | Ga0466657_146344 | 3300042582 | Bacteria | 19012 |
| 45 | Ga0123354_10067571 | 3300010882 | Bacteria | 5205 |
| 46 | Ga0160442_100142 | 3300012806 | Bacteria | 69485 |
| 47 | DPO_contig06928 | 2032320009 | Unclassified | 6757 |
| 48 | DPOL_contig14923 | 2035918003 | Unclassified | 13493 |
| 49 | CVPL010W_10005153 | 3300002931 | Bacteria | 14123 |
| 50 | Ga0103263_103876 | 3300007042 | Bacteria | 1763 |
| 51 | Ga0102738_1000151 | 3300007141 | Bacteria | 18779 |
| 52 | Ga0103264_1002096 | 3300007188 | Bacteria | 9148 |
| 53 | Ga0466730_050878 | 3300042625 | Bacteria | 31540 |
| 54 | Ga0466703_167760 | 3300042636 | Bacteria | 3543 |
| 55 | Ga0466724_25034 | 3300042649 | Bacteria | 837337 |
| 56 | Ga0466724_56971 | 3300042649 | Bacteria | 3334 |
| 57 | Ga0466701_050491 | 3300042598 | Unclassified | 2460 |
| 58 | Ga0466701_098710 | 3300042598 | Bacteria | 149797 |
| 59 | Ga0102736_1000002 | 3300007052 | Bacteria | 204958 |
| 60 | Ga0103266_1000634 | 3300007067 | Unclassified | 6919 |
| 61 | Ga0466730_038558 | 3300042625 | Bacteria | 566435 |
| 62 | Ga0466725_242990 | 3300042654 | Bacteria | 15174 |
| 63 | Ga0160453_100963 | 3300012814 | Unclassified | 13468 |
| 64 | Ga0160469_100731 | 3300012824 | Unclassified | 12264 |
| 65 | Ga0160441_101074 | 3300012825 | Unclassified | 11151 |
| 66 | Ga0160459_104652 | 3300012831 | Bacteria | 1843 |
| 67 | Ga0160447_100030 | 3300012849 | Bacteria | 210871 |
| 68 | Ga0160447_104699 | 3300012849 | Unclassified | 3980 |
| 69 | Ga0466657_085391 | 3300042582 | Bacteria | 3047 |
| 70 | Ga0123356_10178867 | 3300010049 | Bacteria | 2141 |
| 71 | Ga0160471_100066 | 3300012812 | Bacteria | 105379 |
| 72 | Ga0466711_424872 | 3300042615 | Bacteria | 5633 |
| 73 | DPO_contig00870 | 2032320009 | Unclassified | 20000 |
| 74 | IMNBGM34_c000090 | 3300000036 | Bacteria | 26347 |
| 75 | CVPL010W_10011775 | 3300002931 | Bacteria | 7175 |
| 76 | Ga0102737_1000050 | 3300007142 | Bacteria | 71117 |
| 77 | Ga0466734_041225 | 3300042623 | Bacteria | 32984 |
| 78 | Ga0466709_060562 | 3300042648 | Bacteria | 9098 |
| 79 | Ga0466724_01086 | 3300042649 | Bacteria | 97579 |
| 80 | Ga0466724_46819 | 3300042649 | Bacteria | 306737 |
| 81 | Ga0466701_047715 | 3300042598 | Bacteria | 95995 |
| 82 | Ga0160458_102251 | 3300012832 | Bacteria | 2700 |
| 83 | Ga0160447_102717 | 3300012849 | Unclassified | 6043 |
| 84 | Ga0160435_1000906 | 3300012857 | Bacteria | 8029 |
| 85 | Ga0466693_405835 | 3300042592 | Bacteria | 1896 |
| 86 | Ga0466694_168655 | 3300042594 | Bacteria | 2813 |
| 87 | Ga0123355_10020159 | 3300009826 | Bacteria | 10638 |
| 88 | Ga0123356_10163197 | 3300010049 | Unclassified | 2229 |
| 89 | Ga0160442_100006 | 3300012806 | Bacteria | 536179 |
| 90 | Ga0466710_133811 | 3300042613 | Bacteria | 10772 |
| 91 | Ga0466726_365681 | 3300042619 | Bacteria | 1714 |
| 92 | Meta3P_1003806 | 3300002464 | Bacteria | 16599 |
| 93 | Ga0103264_1005734 | 3300007188 | Bacteria | 13602 |
| 94 | Ga0103267_1000111 | 3300007190 | Bacteria | 50521 |
| 95 | Ga0466730_062339 | 3300042625 | Bacteria | 155913 |
| 96 | Ga0466725_033152 | 3300042654 | Bacteria | 8188 |
| 97 | Ga0466701_041263 | 3300042598 | Bacteria | 158002 |
| 98 | Ga0466701_051910 | 3300042598 | Bacteria | 58590 |
| 99 | Ga0160469_100197 | 3300012824 | Bacteria | 54015 |
| 100 | Ga0160446_100084 | 3300012835 | Bacteria | 90262 |
| 101 | Ga0160455_100570 | 3300012837 | Unclassified | 16731 |
| 102 | Ga0466693_078403 | 3300042592 | Bacteria | 3213 |
| 103 | Ga0160454_101703 | 3300012798 | Bacteria | 2994 |
| 104 | Ga0160470_100054 | 3300012813 | Bacteria | 167369 |
| 105 | Ga0102739_1001278 | 3300007095 | Unclassified | 4236 |
| 106 | Ga0105005_1280568 | 3300007505 | Unclassified | 2033 |
| 107 | Ga0466704_238791 | 3300042643 | Bacteria | 33459 |
| 108 | Ga0466701_036390 | 3300042598 | Bacteria | 174320 |
| 109 | Ga0466721_172668 | 3300042608 | Bacteria | 2015 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.