Protein Family IF09741
Metagenome
Isolate
431
Members
266
Samples
272
Scaffolds
269.97
Avg Length
Representative Sequence
- ID
- 3300042649|Ga0466724_27214|Ga0466724_27214_105827_106774
- Length
- 315 aa
- Sequence
- MAHFGYLAALRARPLQEQQHLVYAARHSQSLHAFTRFRTMNSTTSTLRPVRCQYETFMRHVFEHGASKTDRTGTGTRSVFGHQMRFNLSEGFPLVTTKKVHLKSIILELLWFLRGDSNVKWLQERGCTIWDEWADKETGDLGPVYGVQWRSWPKADGTHIDQIAEVVKQLKSSPDSRRIIVSAWNVAELDQMALMPCHSFFQFYVADGKLSCQLYQRSADIFLGVPFNIASYALLTHMLAQQCDLEVGDFIWTGGDCHIYNNHFEQVETQLSRQPFAYPTLNIKRKPDSIFDYEYEDFEVLDYQHHAGIKAPVAV
Sample Types
Isolate
36.9%
Metagenome
63.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
21.8%
Termitidae
9.9%
Formicidae
7.9%
Apidae
7.1%
Culicidae
6.3%
Drosophilidae
4.4%
Kalotermitidae
4.4%
Tenebrionidae
4.4%
Elmidae
4.4%
Anthocoridae
4.0%
Scarabaeidae
3.2%
Curculionidae
3.2%
Cambaridae
2.8%
Armadillidiidae
2.8%
Passalidae
1.2%
Cerambycidae
1.2%
Dytiscidae
1.2%
Ixodidae
0.8%
Termopsidae
0.8%
Rhinotermitidae
0.8%
Aphrophoridae
0.4%
Hydrophilidae
0.4%
Hodotermitidae
0.4%
Crambidae
0.4%
Pyralidae
0.4%
Daphniidae
0.4%
Cimicidae
0.4%
Thripidae
0.4%
Noctuidae
0.4%
Cixiidae
0.4%
Pentatomidae
0.4%
Aphididae
0.4%
Chironomidae
0.4%
Glossinidae
0.4%
Carabidae
0.4%
Rhopalidae
0.4%
Tephritidae
0.4%
Reduviidae
0.4%
Alydidae
0.4%
Taxonomy
Archaea
0
Bacteria
403
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 2 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 3 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 4 | 2597490194 | Bifidobacterium coryneforme LMG 18911 | Isolate | Apidae |
| 5 | 2671180601 | Bifidobacterium asteroides DSM 20089 | Isolate | Unclassified |
| 6 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 7 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 8 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 11 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 12 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 13 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 14 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 15 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 20 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 21 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 25 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 26 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 27 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 28 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 29 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 30 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 31 | 2864964650 | Tsukamurella ocularis S00236 | Isolate | Elmidae |
| 32 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 33 | 2884613238 | Agromyces intestinalis KACC 19306 | Isolate | Scarabaeidae |
| 34 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 35 | 2915157839 | Leucobacter sp. cx-42 | Isolate | Cambaridae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 40 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 41 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 42 | 2684622920 | Bifidobacterium asteroides Bi_200 | Isolate | Unclassified |
| 43 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 44 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 45 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 46 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 47 | 2802429577 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 48 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 49 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 50 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 51 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 52 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 53 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 54 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 55 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 56 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 57 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 58 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 59 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 60 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 61 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 62 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 63 | 2864918810 | Tsukamurella ocularis S00175 | Isolate | Elmidae |
| 64 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 65 | 2873614151 | Leucobacter viscericola HDW9C | Isolate | Dytiscidae |
| 66 | 2879643867 | Bifidobacterium sp. wkB344 | Isolate | Apidae |
| 67 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 68 | 2894897082 | Leucobacter sp. OLCS4 | Isolate | Anthocoridae |
| 69 | 2894974975 | Leucobacter sp. OLIS6 | Isolate | Anthocoridae |
| 70 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 71 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 72 | 2513237174 | Bifidobacterium asteroides ATCC 25910 | Isolate | Apidae |
| 73 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 74 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 75 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 76 | 2645727657 | Bifidobacterium actinocoloniiforme DSM 22766 | Isolate | Unclassified |
| 77 | 2675903013 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 78 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 79 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 80 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 81 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 82 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 83 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 84 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 85 | 8077775691 | Tsukamurella sp. PLM1 | Isolate | Formicidae |
| 86 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 87 | 2820845766 | Unclassified Actinobacteria Lab288P3bin96 | Isolate | Unclassified |
| 88 | 2820849606 | Unclassified Actinobacteria Lab288P3bin39 | Isolate | Unclassified |
| 89 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 90 | 2824199081 | Bifidobacterium commune DSM 28792 | Isolate | Unclassified |
| 91 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 92 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 93 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 94 | 2894944011 | Leucobacter sp. OLAS13 | Isolate | Anthocoridae |
| 95 | 2915166107 | Leucobacter sp. cx-87 | Isolate | Cambaridae |
| 96 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 97 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 98 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 99 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 100 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 101 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 102 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 103 | 2568526170 | Bifidobacterium sp. A11 | Isolate | Apidae |
| 104 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 105 | 2600255079 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 106 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 107 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 108 | 2684622919 | Bifidobacterium asteroides Bi_199 | Isolate | Unclassified |
| 109 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 110 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 111 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 112 | 3002678670 | Agromyces sp. G127AT | Isolate | Unclassified |
| 113 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Drosophilidae |
| 114 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 115 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 116 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 117 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 118 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 119 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 120 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 121 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 122 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 123 | 8024986378 | Bifidobacterium asteroides ESL0198 | Isolate | Apidae |
| 124 | 8032009961 | Bifidobacterium indicum ESL0197 | Isolate | Apidae |
| 125 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 126 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 127 | 2820834831 | Unclassified Actinobacteria Lab288P4bin79 | Isolate | Unclassified |
| 128 | 2820840446 | Unclassified Actinobacteria Lab288P4bin17 | Isolate | Unclassified |
| 129 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 130 | 2861945162 | Microbacterium sp. AR7-10 | Isolate | Culicidae |
| 131 | 2873617540 | Leucobacter insecticola HDW9B | Isolate | Dytiscidae |
| 132 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 133 | 2894900265 | Leucobacter sp. OLTLW20 | Isolate | Anthocoridae |
| 134 | 2894929448 | Leucobacter sp. OAMSW11 | Isolate | Anthocoridae |
| 135 | 2915168811 | Leucobacter sp. cx-169 | Isolate | Cambaridae |
| 136 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 137 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 138 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 139 | 8110340172 | Bifidobacterium choladohabitans B14384H11 | Isolate | Apidae |
| 140 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 141 | 2519899775 | Bifidobacterium asteroides PRL2011 | Isolate | Apidae |
| 142 | 2524023214 | Leucobacter chironomi DSM 19883 | Isolate | Chironomidae |
| 143 | 2663763384 | Bifidobacterium bombi DSM 19703 | Isolate | Apidae |
| 144 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 145 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 146 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 147 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 148 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 149 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 150 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 151 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 152 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 153 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 154 | 8067987626 | Agromyces larvae CFWR-12 | Isolate | Unclassified |
| 155 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 156 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 157 | 2820914081 | Unclassified Actinobacteria Emb289P3bin87 | Isolate | Unclassified |
| 158 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 159 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 160 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 161 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 162 | 2865983822 | Bifidobacterium xylocopae XV2 | Isolate | Apidae |
| 163 | 2894932631 | Leucobacter sp. OAMLP11 | Isolate | Anthocoridae |
| 164 | 2894966443 | Leucobacter sp. OLCALW19 | Isolate | Anthocoridae |
| 165 | 2910090113 | Kocuria sp. cx-116 | Isolate | Cambaridae |
| 166 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 167 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 168 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 169 | 8110341875 | Bifidobacterium polysaccharolyticum W8117 | Isolate | Apidae |
| 170 | 2808606957 | Bifidobacterium sp. ESL0447 | Isolate | Unclassified |
| 171 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 172 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 173 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 174 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 175 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 176 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 177 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 178 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 179 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 180 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 181 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 182 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 183 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 184 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 185 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 186 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 187 | 2820803007 | Unclassified Actinobacteria Th196P3bin61 | Isolate | Unclassified |
| 188 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 189 | 2820842553 | Unclassified Actinobacteria Lab288P4bin104 | Isolate | Unclassified |
| 190 | 2820929059 | Unclassified Actinobacteria Emb289P3bin110 | Isolate | Unclassified |
| 191 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 192 | 2847305884 | Microbacterium protaetiae DFW100M-13 | Isolate | Scarabaeidae |
| 193 | 2864773010 | Tsukamurella ocularis S00022 | Isolate | Elmidae |
| 194 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 195 | 2894981435 | Leucobacter sp. OLDS2 | Isolate | Anthocoridae |
| 196 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 197 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 198 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 199 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 200 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 201 | 2684622918 | Bifidobacterium asteroides Bi_198 | Isolate | Unclassified |
| 202 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 203 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 204 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 205 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 206 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 207 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 208 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 209 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 210 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 211 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 212 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 213 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 214 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 215 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 216 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 217 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 218 | 8024981139 | Bifidobacterium asteroides ESL0170 | Isolate | Apidae |
| 219 | 8024984606 | Bifidobacterium asteroides ESL0199 | Isolate | Apidae |
| 220 | 8069511479 | Arthrobacter ipsi IA7 | Isolate | Curculionidae |
| 221 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 222 | 2836973655 | Gryllotalpicola protaetiae 2DFW10M-5 | Isolate | Scarabaeidae |
| 223 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 224 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 225 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 226 | 2894926108 | Leucobacter sp. OLES1 | Isolate | Anthocoridae |
| 227 | 2918390780 | Glutamicibacter protophormiae DSM 20168 | Isolate | Unclassified |
| 228 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 229 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 230 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 231 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 232 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 233 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 234 | 2545824723 | Rhodococcus rhodnii LMG 5362 | Isolate | Reduviidae |
| 235 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 236 | 2660238275 | Bifidobacterium indicum DSM 20214 | Isolate | Unclassified |
| 237 | 2684622916 | Bifidobacterium asteroides Bi_170 | Isolate | Unclassified |
| 238 | 2684622917 | Bifidobacterium coryneforme Bi_197 | Isolate | Unclassified |
| 239 | 2693429521 | Bifidobacterium coryneforme DSM 20216 | Isolate | Unclassified |
| 240 | 2788500098 | Bombiscardovia coagulans DSM 22924 | Isolate | Apidae |
| 241 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 242 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 243 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 244 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 245 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 246 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 247 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 248 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 249 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 250 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 251 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 252 | 8024982947 | Bifidobacterium asteroides ESL0200 | Isolate | Apidae |
| 253 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 254 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 255 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 256 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 257 | 2820894511 | Unclassified Actinobacteria Lab288P1bin103 | Isolate | Unclassified |
| 258 | 2820911766 | Unclassified Actinobacteria Emb289P3bin96 | Isolate | Unclassified |
| 259 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 260 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 261 | 2873620646 | Leucobacter coleopterorum HDW9A | Isolate | Dytiscidae |
| 262 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 263 | 2894935787 | Leucobacter sp. OLJS4 | Isolate | Anthocoridae |
| 264 | 2909881144 | Kocuria sp. cx-455 | Isolate | Cambaridae |
| 265 | 2915160415 | Leucobacter sp. cx-328 | Isolate | Cambaridae |
| 266 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562379_0662 | 3300056790 | Bacteria | 59869 |
| 2 | Ga0562376_0875 | 3300056857 | Bacteria | 47570 |
| 3 | Ga0562376_1740 | 3300056857 | Bacteria | 29247 |
| 4 | Ga0123356_10003998 | 3300010049 | Bacteria | 15317 |
| 5 | AustNasuHG_c1008459 | 3300000089 | Bacteria | 3639 |
| 6 | CVPL010W_10027173 | 3300002931 | Bacteria | 2891 |
| 7 | CVPL010L_1000195 | 3300002932 | Bacteria | 16890 |
| 8 | CVPL010L_1000213 | 3300002932 | Unclassified | 15848 |
| 9 | Ga0072940_1027165 | 3300005200 | Bacteria | 13674 |
| 10 | Ga0074302_1136115 | 3300005316 | Bacteria | 2091 |
| 11 | Ga0074278_131618 | 3300005721 | Bacteria | 7837 |
| 12 | Ga0102739_1009021 | 3300007095 | Bacteria | 1303 |
| 13 | Ga0102734_1007441 | 3300007129 | Unclassified | 3251 |
| 14 | Ga0104050_1201202 | 3300007153 | Bacteria | 1908 |
| 15 | Ga0103268_1001157 | 3300007192 | Unclassified | 6912 |
| 16 | Ga0466701_080288 | 3300042598 | Bacteria | 9905 |
| 17 | Ga0466700_245533 | 3300042600 | Bacteria | 11703 |
| 18 | Ga0466722_005617 | 3300042609 | Bacteria | 30300 |
| 19 | Ga0160432_100220 | 3300012818 | Bacteria | 49010 |
| 20 | Ga0160459_102262 | 3300012831 | Bacteria | 3250 |
| 21 | Ga0160433_111392 | 3300012846 | Bacteria | 1135 |
| 22 | Ga0160445_100083 | 3300012847 | Bacteria | 103259 |
| 23 | Ga0160443_100074 | 3300012848 | Bacteria | 181634 |
| 24 | Ga0160430_100603 | 3300012852 | Bacteria | 18318 |
| 25 | Ga0466728_156791 | 3300042620 | Bacteria | 20989 |
| 26 | Ga0466728_420411 | 3300042620 | Bacteria | 2976 |
| 27 | Ga0466731_249946 | 3300042622 | Bacteria | 6430 |
| 28 | Ga0466734_073449 | 3300042623 | Bacteria | 8528 |
| 29 | Ga0466734_109657 | 3300042623 | Bacteria | 14627 |
| 30 | Ga0466730_008933 | 3300042625 | Bacteria | 1142 |
| 31 | Ga0466730_097984 | 3300042625 | Bacteria | 727286 |
| 32 | Ga0466724_27214 | 3300042649 | Bacteria | 319260 |
| 33 | Ga0466724_43696 | 3300042649 | Bacteria | 561295 |
| 34 | Ga0466725_116062 | 3300042654 | Bacteria | 7976 |
| 35 | Ga0466725_165981 | 3300042654 | Bacteria | 2561 |
| 36 | Ga0562379_0007 | 3300056790 | Bacteria | 2440168 |
| 37 | Ga0562379_0061 | 3300056790 | Bacteria | 462291 |
| 38 | Ga0123355_10000308 | 3300009826 | Bacteria | 62784 |
| 39 | Ga0123353_10053178 | 3300010167 | Bacteria | 6473 |
| 40 | Ga0123354_10000714 | 3300010882 | Bacteria | 35629 |
| 41 | Ga0160464_100545 | 3300012805 | Bacteria | 25833 |
| 42 | Ga0160466_100258 | 3300012809 | Bacteria | 35321 |
| 43 | AustNasuHG_c1035916 | 3300000089 | Bacteria | 1296 |
| 44 | CVPL010W_10000220 | 3300002931 | Bacteria | 52602 |
| 45 | CVPL010W_10029036 | 3300002931 | Bacteria | 2606 |
| 46 | CVPL005L_10007465 | 3300002938 | Bacteria | 10291 |
| 47 | CVPL005L_10018321 | 3300002938 | Bacteria | 3925 |
| 48 | Ga0068302_10195473 | 3300005071 | Bacteria | 1216 |
| 49 | Ga0102735_1000182 | 3300007080 | Bacteria | 19417 |
| 50 | Ga0102734_1016006 | 3300007129 | Bacteria | 1821 |
| 51 | Ga0103260_1002180 | 3300007139 | Bacteria | 6572 |
| 52 | Ga0102740_1000157 | 3300007140 | Bacteria | 18676 |
| 53 | Ga0102740_1001394 | 3300007140 | Bacteria | 6173 |
| 54 | Ga0104019_1196208 | 3300007150 | Bacteria | 1165 |
| 55 | Ga0103264_1034385 | 3300007188 | Bacteria | 2273 |
| 56 | Ga0103268_1027628 | 3300007192 | Bacteria | 1324 |
| 57 | Ga0466701_071577 | 3300042598 | Bacteria | 40192 |
| 58 | Ga0466701_103351 | 3300042598 | Bacteria | 92538 |
| 59 | Ga0466714_072782 | 3300042603 | Bacteria | 9790 |
| 60 | Ga0466714_138976 | 3300042603 | Bacteria | 3229 |
| 61 | Ga0160447_101116 | 3300012849 | Bacteria | 10811 |
| 62 | Ga0466690_025948 | 3300042590 | Bacteria | 7136 |
| 63 | Ga0466693_196387 | 3300042592 | Bacteria | 116150 |
| 64 | Ga0466696_134366 | 3300042596 | Bacteria | 1676 |
| 65 | Ga0466696_280548 | 3300042596 | Bacteria | 3829 |
| 66 | Ga0466699_174359 | 3300042597 | Bacteria | 1225 |
| 67 | Ga0466718_099837 | 3300042617 | Bacteria | 7860 |
| 68 | Ga0466729_180952 | 3300042621 | Bacteria | 1557 |
| 69 | Ga0466731_105490 | 3300042622 | Bacteria | 5191 |
| 70 | Ga0530661_000403 | 3300056564 | Bacteria | 32492 |
| 71 | Ga0530661_024645 | 3300056564 | Bacteria | 1720 |
| 72 | Ga0562375_1477 | 3300056856 | Bacteria | 31484 |
| 73 | Ga0160465_102344 | 3300012803 | Bacteria | 4234 |
| 74 | CVPL005W_1000003 | 3300002934 | Bacteria | 103415 |
| 75 | Ga0104048_1176668 | 3300007143 | Bacteria | 974 |
| 76 | Ga0103267_1001078 | 3300007190 | Bacteria | 6812 |
| 77 | Ga0103268_1000165 | 3300007192 | Bacteria | 21842 |
| 78 | Ga0466706_135634 | 3300042599 | Bacteria | 14355 |
| 79 | Ga0466707_239403 | 3300042601 | Bacteria | 17751 |
| 80 | Ga0466707_419251 | 3300042601 | Bacteria | 2795 |
| 81 | Ga0160453_102677 | 3300012814 | Bacteria | 4169 |
| 82 | Ga0160431_106448 | 3300012828 | Unclassified | 1779 |
| 83 | Ga0160459_103128 | 3300012831 | Bacteria | 2454 |
| 84 | Ga0160452_100003 | 3300012834 | Bacteria | 748778 |
| 85 | Ga0160455_100549 | 3300012837 | Bacteria | 17421 |
| 86 | Ga0160430_104081 | 3300012852 | Bacteria | 3770 |
| 87 | Ga0466731_188903 | 3300042622 | Bacteria | 3713 |
| 88 | Ga0466734_114206 | 3300042623 | Bacteria | 16061 |
| 89 | Ga0466730_068054 | 3300042625 | Bacteria | 17692 |
| 90 | Ga0466697_251762 | 3300042611 | Bacteria | 2081 |
| 91 | Ga0562375_0062 | 3300056856 | Bacteria | 424406 |
| 92 | Ga0123354_10000110 | 3300010882 | Bacteria | 61008 |
| 93 | Ga0123354_10069896 | 3300010882 | Bacteria | 5086 |
| 94 | Ga0160465_100036 | 3300012803 | Bacteria | 180718 |
| 95 | FGTW_contig34086 | 2065487013 | Bacteria | 1008 |
| 96 | IMNBGM34_c000736 | 3300000036 | Bacteria | 7770 |
| 97 | Meta3P_1000005 | 3300002464 | Bacteria | 4922 |
| 98 | CVPL010W_10012565 | 3300002931 | Bacteria | 6708 |
| 99 | CVPL005W_1000304 | 3300002934 | Bacteria | 21240 |
| 100 | CVPL005L_10002290 | 3300002938 | Bacteria | 21967 |
| 101 | Ga0074309_1098285 | 3300005314 | Unclassified | 1504 |
| 102 | Ga0104045_1003916 | 3300007085 | Unclassified | 3387 |
| 103 | Ga0103260_1000457 | 3300007139 | Bacteria | 7802 |
| 104 | Ga0102740_1002458 | 3300007140 | Bacteria | 4256 |
| 105 | Ga0102737_1003197 | 3300007142 | Bacteria | 3814 |
| 106 | Ga0103264_1000266 | 3300007188 | Bacteria | 29657 |
| 107 | Ga0466706_080441 | 3300042599 | Bacteria | 247551 |
| 108 | Ga0466716_105103 | 3300042605 | Bacteria | 4697 |
| 109 | Ga0466722_109296 | 3300042609 | Bacteria | 4682 |
| 110 | Ga0160453_101146 | 3300012814 | Unclassified | 10931 |
| 111 | Ga0160443_100075 | 3300012848 | Bacteria | 178644 |
| 112 | Ga0160448_100692 | 3300012854 | Bacteria | 11364 |
| 113 | Ga0160435_1002266 | 3300012857 | Bacteria | 4694 |
| 114 | Ga0160457_1001516 | 3300012858 | Bacteria | 6294 |
| 115 | Ga0160457_1008583 | 3300012858 | Bacteria | 1470 |
| 116 | Ga0466657_236445 | 3300042582 | Bacteria | 5049 |
| 117 | Ga0466693_047195 | 3300042592 | Bacteria | 1936 |
| 118 | Ga0466696_098633 | 3300042596 | Bacteria | 11417 |
| 119 | Ga0466701_001631 | 3300042598 | Bacteria | 74647 |
| 120 | Ga0466728_199477 | 3300042620 | Bacteria | 17849 |
| 121 | Ga0466730_002434 | 3300042625 | Bacteria | 40320 |
| 122 | Ga0466730_013812 | 3300042625 | Bacteria | 185537 |
| 123 | Ga0466703_193348 | 3300042636 | Bacteria | 10423 |
| 124 | Ga0466703_432324 | 3300042636 | Bacteria | 3307 |
| 125 | Ga0466724_38523 | 3300042649 | Bacteria | 121795 |
| 126 | Ga0466724_66581 | 3300042649 | Bacteria | 665985 |
| 127 | Ga0466708_117808 | 3300042652 | Bacteria | 12283 |
| 128 | Ga0466725_210837 | 3300042654 | Bacteria | 2752 |
| 129 | Ga0466725_384056 | 3300042654 | Bacteria | 3511 |
| 130 | Ga0466733_029496 | 3300042659 | Bacteria | 46820 |
| 131 | Ga0123357_10043990 | 3300009784 | Bacteria | 6064 |
| 132 | Ga0123356_10013424 | 3300010049 | Bacteria | 7907 |
| 133 | Ga0123353_10386144 | 3300010167 | Bacteria | 2092 |
| 134 | Ga0123354_10000200 | 3300010882 | Bacteria | 51621 |
| 135 | Ga0123354_10156474 | 3300010882 | Bacteria | 2731 |
| 136 | CVPL010W_10005020 | 3300002931 | Bacteria | 14629 |
| 137 | CVPL005W_1000002 | 3300002934 | Bacteria | 113206 |
| 138 | CVPL005L_10000150 | 3300002938 | Bacteria | 55230 |
| 139 | Ga0102734_1007084 | 3300007129 | Bacteria | 2819 |
| 140 | Ga0102738_1000114 | 3300007141 | Unclassified | 24934 |
| 141 | Ga0102738_1003191 | 3300007141 | Bacteria | 3653 |
| 142 | Ga0102737_1000902 | 3300007142 | Bacteria | 8970 |
| 143 | Ga0102737_1000932 | 3300007142 | Bacteria | 8767 |
| 144 | Ga0103264_1000664 | 3300007188 | Bacteria | 38164 |
| 145 | Ga0103264_1001829 | 3300007188 | Bacteria | 9450 |
| 146 | Ga0103264_1002220 | 3300007188 | Bacteria | 8699 |
| 147 | Ga0103267_1000402 | 3300007190 | Bacteria | 14129 |
| 148 | Ga0103267_1009962 | 3300007190 | Bacteria | 2866 |
| 149 | Ga0127656_100210 | 3300009453 | Bacteria | 19172 |
| 150 | Ga0466713_117968 | 3300042602 | Bacteria | 408806 |
| 151 | Ga0466713_120611 | 3300042602 | Bacteria | 132686 |
| 152 | Ga0160432_103431 | 3300012818 | Bacteria | 2386 |
| 153 | Ga0160455_100033 | 3300012837 | Unclassified | 315701 |
| 154 | Ga0160444_100188 | 3300012841 | Bacteria | 56263 |
| 155 | Ga0160457_1000016 | 3300012858 | Bacteria | 412496 |
| 156 | Ga0466691_085554 | 3300042593 | Bacteria | 5302 |
| 157 | Ga0466711_106356 | 3300042615 | Bacteria | 13532 |
| 158 | Ga0466730_009746 | 3300042625 | Unclassified | 28418 |
| 159 | Ga0466730_090618 | 3300042625 | Bacteria | 14131 |
| 160 | Ga0466730_098284 | 3300042625 | Unclassified | 1505 |
| 161 | Ga0466703_389534 | 3300042636 | Bacteria | 1815 |
| 162 | Ga0466724_23798 | 3300042649 | Bacteria | 69412 |
| 163 | Ga0466708_067625 | 3300042652 | Bacteria | 12503 |
| 164 | Ga0466725_029016 | 3300042654 | Bacteria | 12252 |
| 165 | Ga0466725_136593 | 3300042654 | Bacteria | 3809 |
| 166 | Ga0562377_0177 | 3300056842 | Bacteria | 171910 |
| 167 | Ga0562375_2792 | 3300056856 | Bacteria | 18414 |
| 168 | Ga0562374_1262 | 3300057007 | Bacteria | 30964 |
| 169 | Ga0123353_10158819 | 3300010167 | Bacteria | 3601 |
| 170 | Ga0123354_10069573 | 3300010882 | Bacteria | 5102 |
| 171 | Ga0160471_100112 | 3300012812 | Bacteria | 38684 |
| 172 | 2227480185 | 2225789004 | Bacteria | 78759 |
| 173 | AustNasuHG_c1000638 | 3300000089 | Bacteria | 12397 |
| 174 | CVPL010W_10028831 | 3300002931 | Unclassified | 2604 |
| 175 | CVPL005L_10026942 | 3300002938 | Bacteria | 2222 |
| 176 | Ga0063521_1000683 | 3300003973 | Unclassified | 13021 |
| 177 | Ga0068302_10230591 | 3300005071 | Bacteria | 2022 |
| 178 | Ga0102736_1008719 | 3300007052 | Bacteria | 1189 |
| 179 | Ga0103265_1000005 | 3300007068 | Bacteria | 101135 |
| 180 | Ga0102735_1000885 | 3300007080 | Bacteria | 5485 |
| 181 | Ga0102739_1005556 | 3300007095 | Bacteria | 1720 |
| 182 | Ga0102737_1006345 | 3300007142 | Bacteria | 2261 |
| 183 | Ga0103264_1001535 | 3300007188 | Bacteria | 13008 |
| 184 | Ga0103267_1002307 | 3300007190 | Bacteria | 4835 |
| 185 | Ga0103268_1000799 | 3300007192 | Bacteria | 8795 |
| 186 | Ga0466701_044464 | 3300042598 | Bacteria | 300143 |
| 187 | Ga0466714_161639 | 3300042603 | Bacteria | 2549 |
| 188 | Ga0466716_312997 | 3300042605 | Bacteria | 2267 |
| 189 | Ga0160431_101427 | 3300012828 | Unclassified | 6870 |
| 190 | Ga0160446_100200 | 3300012835 | Bacteria | 41954 |
| 191 | Ga0466710_246207 | 3300042613 | Bacteria | 1053 |
| 192 | Ga0466728_470073 | 3300042620 | Bacteria | 15731 |
| 193 | Ga0466734_121892 | 3300042623 | Bacteria | 16486 |
| 194 | Ga0466724_67835 | 3300042649 | Bacteria | 278968 |
| 195 | Ga0466725_225420 | 3300042654 | Bacteria | 2379 |
| 196 | Ga0562377_0013 | 3300056842 | Bacteria | 1229680 |
| 197 | Ga0562376_0033 | 3300056857 | Bacteria | 349823 |
| 198 | Ga0123355_10000074 | 3300009826 | Bacteria | 105380 |
| 199 | Ga0123353_10010419 | 3300010167 | Bacteria | 12960 |
| 200 | Ga0160471_100012 | 3300012812 | Bacteria | 433895 |
| 201 | IMNBL1DRAFT_c0000487 | 3300000062 | Bacteria | 33116 |
| 202 | Ga0102736_1001620 | 3300007052 | Bacteria | 3869 |
| 203 | Ga0104051_1016887 | 3300007078 | Bacteria | 3219 |
| 204 | Ga0103261_1000718 | 3300007083 | Unclassified | 5023 |
| 205 | Ga0102740_1008184 | 3300007140 | Bacteria | 2610 |
| 206 | Ga0102737_1000078 | 3300007142 | Unclassified | 29525 |
| 207 | Ga0102737_1004717 | 3300007142 | Unclassified | 2846 |
| 208 | Ga0104019_1036053 | 3300007150 | Unclassified | 4733 |
| 209 | Ga0103264_1043407 | 3300007188 | Bacteria | 2521 |
| 210 | Ga0466714_054605 | 3300042603 | Bacteria | 1665 |
| 211 | Ga0466716_074404 | 3300042605 | Bacteria | 19458 |
| 212 | Ga0160440_100048 | 3300012815 | Bacteria | 166974 |
| 213 | Ga0160469_100080 | 3300012824 | Bacteria | 156212 |
| 214 | Ga0160431_103902 | 3300012828 | Bacteria | 2892 |
| 215 | Ga0160433_103411 | 3300012846 | Unclassified | 2873 |
| 216 | Ga0160434_100005 | 3300012850 | Bacteria | 405350 |
| 217 | Ga0160434_101140 | 3300012850 | Unclassified | 5277 |
| 218 | Ga0160436_1000334 | 3300012861 | Bacteria | 20050 |
| 219 | Ga0466657_015947 | 3300042582 | Bacteria | 203876 |
| 220 | Ga0466691_006289 | 3300042593 | Bacteria | 18431 |
| 221 | Ga0466699_090039 | 3300042597 | Bacteria | 3802 |
| 222 | Ga0466699_131643 | 3300042597 | Bacteria | 1866 |
| 223 | Ga0466710_333332 | 3300042613 | Bacteria | 1451 |
| 224 | Ga0466715_191200 | 3300042616 | Bacteria | 1909 |
| 225 | Ga0466730_083333 | 3300042625 | Bacteria | 2847 |
| 226 | Ga0466703_086189 | 3300042636 | Bacteria | 3814 |
| 227 | Ga0466725_059116 | 3300042654 | Bacteria | 97832 |
| 228 | Ga0466725_349799 | 3300042654 | Bacteria | 2652 |
| 229 | Ga0466705_117313 | 3300042612 | Bacteria | 1159 |
| 230 | Ga0466733_095523 | 3300042659 | Bacteria | 1356 |
| 231 | Ga0562378_0013 | 3300056814 | Bacteria | 998154 |
| 232 | Ga0562378_0069 | 3300056814 | Bacteria | 294245 |
| 233 | Ga0123356_10000150 | 3300010049 | Bacteria | 78432 |
| 234 | Ga0123356_10380104 | 3300010049 | Bacteria | 1545 |
| 235 | Ga0160464_100034 | 3300012805 | Bacteria | 170255 |
| 236 | HBC_ctgsDRAFT_1027036 | 3300000333 | Bacteria | 1408 |
| 237 | Ga0072940_1050561 | 3300005200 | Bacteria | 7782 |
| 238 | Ga0072940_1371689 | 3300005200 | Bacteria | 1369 |
| 239 | Ga0072941_1003861 | 3300005201 | Bacteria | 31533 |
| 240 | Ga0102736_1003992 | 3300007052 | Bacteria | 3543 |
| 241 | Ga0102735_1007969 | 3300007080 | Bacteria | 1337 |
| 242 | Ga0104041_1002037 | 3300007106 | Bacteria | 2960 |
| 243 | Ga0102734_1000293 | 3300007129 | Bacteria | 15232 |
| 244 | Ga0102740_1002515 | 3300007140 | Bacteria | 4177 |
| 245 | Ga0102740_1009658 | 3300007140 | Unclassified | 1550 |
| 246 | Ga0102738_1001938 | 3300007141 | Bacteria | 3135 |
| 247 | Ga0104048_1025457 | 3300007143 | Unclassified | 2240 |
| 248 | Ga0104048_1171358 | 3300007143 | Unclassified | 1499 |
| 249 | Ga0104050_1000894 | 3300007153 | Unclassified | 5957 |
| 250 | Ga0103264_1000013 | 3300007188 | Bacteria | 122810 |
| 251 | Ga0103264_1022659 | 3300007188 | Bacteria | 3027 |
| 252 | Ga0103267_1003296 | 3300007190 | Bacteria | 4278 |
| 253 | Ga0105005_1014862 | 3300007505 | Unclassified | 2944 |
| 254 | Ga0105553_1035303 | 3300007767 | Unclassified | 33222 |
| 255 | Ga0466701_038973 | 3300042598 | Bacteria | 90174 |
| 256 | Ga0466701_061654 | 3300042598 | Bacteria | 1327 |
| 257 | Ga0466714_007827 | 3300042603 | Bacteria | 3629 |
| 258 | Ga0466714_147966 | 3300042603 | Bacteria | 24329 |
| 259 | Ga0160453_101908 | 3300012814 | Unclassified | 5961 |
| 260 | Ga0160452_100244 | 3300012834 | Bacteria | 53561 |
| 261 | Ga0160472_101803 | 3300012839 | Bacteria | 5534 |
| 262 | Ga0160433_100008 | 3300012846 | Bacteria | 311360 |
| 263 | Ga0160430_100402 | 3300012852 | Bacteria | 26029 |
| 264 | Ga0160430_101736 | 3300012852 | Unclassified | 7680 |
| 265 | Ga0466657_083125 | 3300042582 | Bacteria | 2325 |
| 266 | Ga0466729_304783 | 3300042621 | Bacteria | 3746 |
| 267 | Ga0466730_103221 | 3300042625 | Bacteria | 88398 |
| 268 | Ga0466704_253192 | 3300042643 | Bacteria | 3138 |
| 269 | Ga0466724_15492 | 3300042649 | Bacteria | 3389 |
| 270 | Ga0466724_37237 | 3300042649 | Bacteria | 305109 |
| 271 | Ga0466724_47439 | 3300042649 | Bacteria | 410820 |
| 272 | Ga0466727_148348 | 3300042655 | Bacteria | 6026 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00303 | Thymidylat_synt | Thymidylate synthase | 53 | 315 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.