Protein Family IF09695
Metagenome
Isolate
187
Members
148
Samples
95
Scaffolds
219.64
Avg Length
Representative Sequence
- ID
- 3300042649|Ga0466724_02653|Ga0466724_02653_3006_3719
- Length
- 237 aa
- Sequence
- MKIDVCLLYRLRDNLLQMEQDMKSIAVILSGCGVFDGSEVHESVLTMLALSQNNAKVYFFAPDELQPTVINHINGNEKTEKRNQLEESARITRGEISPLSSADASKLDALIIPGGFGAAKNLCNFAVKGSDCEINKELLSLVRQMHQQKKPLGLMCIAPVMLPKMLNTSVKLTIGDDSETIIQIENMGGKHIKCSVDDIVVDEVNRVVTTPAYMLAQSISEANIGINKLVKKVLEMA
Sample Types
Isolate
49.2%
Metagenome
50.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
14.5%
Muscidae
8.7%
Curculionidae
8.7%
Drosophilidae
7.2%
Tenebrionidae
7.2%
Culicidae
6.5%
Formicidae
6.5%
Calliphoridae
5.8%
Elmidae
5.1%
Termitidae
4.3%
Kalotermitidae
3.6%
Armadillidiidae
2.9%
Tephritidae
2.2%
Sarcophagidae
1.4%
Apidae
1.4%
Rhinotermitidae
1.4%
Passalidae
1.4%
Cerambycidae
1.4%
Plutellidae
1.4%
Scarabaeidae
0.7%
Trigoniulidae
0.7%
Anthomyiidae
0.7%
Gryllidae
0.7%
Siricidae
0.7%
Crambidae
0.7%
Pteromalidae
0.7%
Pentatomidae
0.7%
Rhopalidae
0.7%
Carabidae
0.7%
Majidae
0.7%
Taxonomy
Archaea
0
Bacteria
165
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 2 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 3 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 4 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 5 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 6 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 7 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 8 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 9 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 10 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 14 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 15 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 16 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 17 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 20 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 21 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 22 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 23 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 24 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 25 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 26 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 27 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 28 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 31 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 32 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 33 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 34 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 35 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 36 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 37 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 38 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 39 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 40 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 41 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 42 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 43 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 44 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 45 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 46 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 47 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 48 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 49 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 50 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 51 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 52 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 53 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 54 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 55 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 56 | 2972038244 | Pseudomonas sp. DS1 | Isolate | Formicidae |
| 57 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 58 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 59 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 60 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 61 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 62 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 63 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 64 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 65 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 66 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 67 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 68 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 69 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 70 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 71 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 72 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 73 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 74 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 75 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 76 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 77 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 78 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 79 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 80 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 81 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 82 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 83 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 84 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 85 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 86 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 87 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 88 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 89 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 90 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 91 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 92 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 93 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 94 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 95 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 96 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 97 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 98 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 99 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 100 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 101 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 102 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 103 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 104 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 105 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 106 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 107 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 108 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 109 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 110 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 111 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 112 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 113 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 114 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 115 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 116 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 117 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 118 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 119 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 120 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 121 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 122 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 123 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 124 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 125 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 126 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 127 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 128 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 129 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 130 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 131 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 132 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 133 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 134 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 135 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 136 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 137 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 138 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 139 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 140 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 141 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 142 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 143 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 144 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 145 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 146 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 147 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 148 | 8035422605 | Pseudomonas monteilii CY06 | Isolate |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160444_100584 | 3300012841 | Bacteria | 13602 |
| 2 | Ga0160444_116584 | 3300012841 | Bacteria | 839 |
| 3 | Ga0265387_1000288 | 3300024582 | Bacteria | 8488 |
| 4 | Ga0102736_1000433 | 3300007052 | Bacteria | 8571 |
| 5 | Ga0104051_1102262 | 3300007078 | Bacteria | 2178 |
| 6 | Ga0466707_077196 | 3300042601 | Bacteria | 48037 |
| 7 | Ga0466713_059695 | 3300042602 | Bacteria | 36243 |
| 8 | Ga0562379_0289 | 3300056790 | Bacteria | 128410 |
| 9 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 10 | Ga0247289_1213 | 3300035363 | Bacteria | 2591 |
| 11 | SWWA_contig19608__length_3701___numreads_73 | 2100351016 | Bacteria | 3701 |
| 12 | Meta3P_1000063 | 3300002464 | Unclassified | 16337 |
| 13 | CVPL005W_1000938 | 3300002934 | Bacteria | 9200 |
| 14 | Ga0123357_10000836 | 3300009784 | Bacteria | 31243 |
| 15 | Ga0466701_063657 | 3300042598 | Bacteria | 38295 |
| 16 | Ga0466722_020309 | 3300042609 | Bacteria | 4420 |
| 17 | Ga0466730_054465 | 3300042625 | Bacteria | 1136 |
| 18 | Ga0466724_08012 | 3300042649 | Bacteria | 67064 |
| 19 | Ga0562378_0105 | 3300056814 | Bacteria | 222310 |
| 20 | Ga0160440_100645 | 3300012815 | Unclassified | 8219 |
| 21 | Ga0160472_100581 | 3300012839 | Bacteria | 20992 |
| 22 | Ga0316159_14725 | 3300030930 | Bacteria | 1881 |
| 23 | Ga0247290_00438 | 3300035364 | Bacteria | 8036 |
| 24 | DPO_contig08731 | 2032320009 | Bacteria | 25815 |
| 25 | FGTW_contig02420 | 2065487013 | Bacteria | 5137 |
| 26 | Ga0103266_1000625 | 3300007067 | Bacteria | 7629 |
| 27 | Ga0102735_1004265 | 3300007080 | Bacteria | 3501 |
| 28 | Ga0103264_1041263 | 3300007188 | Unclassified | 1958 |
| 29 | Ga0466707_146868 | 3300042601 | Bacteria | 3218 |
| 30 | Ga0466719_497213 | 3300042606 | Bacteria | 6549 |
| 31 | Ga0466722_010429 | 3300042609 | Bacteria | 4402 |
| 32 | Ga0466722_151693 | 3300042609 | Bacteria | 2308 |
| 33 | Ga0466730_033232 | 3300042625 | Unclassified | 8483 |
| 34 | Ga0466730_056657 | 3300042625 | Bacteria | 4551 |
| 35 | Ga0466703_363411 | 3300042636 | Bacteria | 6746 |
| 36 | Ga0160433_101662 | 3300012846 | Bacteria | 5761 |
| 37 | Ga0466696_229350 | 3300042596 | Bacteria | 1500 |
| 38 | DPO_contig08106 | 2032320009 | Bacteria | 25636 |
| 39 | SPBB_contig09883 | 2044078006 | Bacteria | 31365 |
| 40 | SWWA_contig00552__length_23778___numreads_1537 | 2100351016 | Bacteria | 23778 |
| 41 | CVPL010L_1000259 | 3300002932 | Bacteria | 21876 |
| 42 | Ga0105005_1090675 | 3300007505 | Unclassified | 11512 |
| 43 | Ga0466701_044033 | 3300042598 | Bacteria | 112210 |
| 44 | Ga0466730_033110 | 3300042625 | Unclassified | 19425 |
| 45 | Ga0466724_22279 | 3300042649 | Bacteria | 15116 |
| 46 | Ga0530661_001016 | 3300056564 | Unclassified | 16374 |
| 47 | Ga0160432_101581 | 3300012818 | Unclassified | 6822 |
| 48 | DPOL_contig02850 | 2035918003 | Bacteria | 36716 |
| 49 | FGTW_contig30586 | 2065487013 | Bacteria | 10232 |
| 50 | 2227358540 | 2225789004 | Bacteria | 138171 |
| 51 | HBC_ctgsDRAFT_1018181 | 3300000333 | Bacteria | 1713 |
| 52 | JGI24705J35276_12235614 | 3300002504 | Bacteria | 6737 |
| 53 | CVPL010L_1000092 | 3300002932 | Bacteria | 28025 |
| 54 | Ga0063521_1000060 | 3300003973 | Bacteria | 95522 |
| 55 | Ga0104049_1131138 | 3300007103 | Unclassified | 3955 |
| 56 | Ga0160470_100147 | 3300012813 | Bacteria | 70669 |
| 57 | Ga0466707_051976 | 3300042601 | Unclassified | 2863 |
| 58 | Ga0466730_034998 | 3300042625 | Bacteria | 1449 |
| 59 | Ga0466730_042292 | 3300042625 | Bacteria | 7090 |
| 60 | Ga0466724_22462 | 3300042649 | Unclassified | 22002 |
| 61 | Ga0466705_301411 | 3300042612 | Bacteria | 2224 |
| 62 | Ga0562374_0048 | 3300057007 | Bacteria | 546035 |
| 63 | Ga0160441_101100 | 3300012825 | Bacteria | 10855 |
| 64 | Ga0160443_113070 | 3300012848 | Unclassified | 920 |
| 65 | Ga0160436_1033044 | 3300012861 | Unclassified | 868 |
| 66 | Ga0316159_12821 | 3300030930 | Unclassified | 1728 |
| 67 | Ga0247289_0044 | 3300035363 | Bacteria | 39742 |
| 68 | FGTW_contig07297 | 2065487013 | Unclassified | 1381 |
| 69 | HBC_ctgsDRAFT_1000018 | 3300000333 | Bacteria | 42985 |
| 70 | Meta3P_1001818 | 3300002464 | Unclassified | 1298 |
| 71 | CVPL010L_1001358 | 3300002932 | Unclassified | 3636 |
| 72 | Ga0102739_1002388 | 3300007095 | Bacteria | 2897 |
| 73 | Ga0160466_100338 | 3300012809 | Bacteria | 28195 |
| 74 | Ga0466730_028926 | 3300042625 | Bacteria | 34701 |
| 75 | Ga0466724_02653 | 3300042649 | Bacteria | 9783 |
| 76 | Ga0466724_40911 | 3300042649 | Bacteria | 49657 |
| 77 | Ga0466733_155817 | 3300042659 | Bacteria | 7824 |
| 78 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 79 | Ga0160433_100101 | 3300012846 | Bacteria | 86629 |
| 80 | Ga0160447_101120 | 3300012849 | Bacteria | 10786 |
| 81 | Ga0160448_119399 | 3300012854 | Bacteria | 1133 |
| 82 | Ga0265387_1000169 | 3300024582 | Bacteria | 11837 |
| 83 | SPBB_contig11585 | 2044078006 | Bacteria | 25836 |
| 84 | FGTW_contig29716 | 2065487013 | Unclassified | 2961 |
| 85 | IMNBL1DRAFT_c0000516 | 3300000062 | Bacteria | 31722 |
| 86 | Ga0103266_1000120 | 3300007067 | Bacteria | 38540 |
| 87 | Ga0160469_100576 | 3300012824 | Unclassified | 15210 |
| 88 | Ga0063521_1000019 | 3300003973 | Bacteria | 139495 |
| 89 | Ga0063521_1000396 | 3300003973 | Bacteria | 24085 |
| 90 | Ga0105005_1186188 | 3300007505 | Bacteria | 1172 |
| 91 | Ga0160465_100996 | 3300012803 | Unclassified | 9481 |
| 92 | Ga0466713_028799 | 3300042602 | Bacteria | 28373 |
| 93 | Ga0466713_136085 | 3300042602 | Unclassified | 2899 |
| 94 | Ga0466704_382798 | 3300042643 | Unclassified | 4144 |
| 95 | Ga0466724_31511 | 3300042649 | Bacteria | 66518 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01965 | DJ-1_PfpI | DJ-1/PfpI family | 35 | 174 | 0.6 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.