Protein Family IF09578
Metagenome
Isolate
132
Members
52
Samples
122
Scaffolds
221.76
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_072602|Ga0466709_072602_2512_3225
- Length
- 237 aa
- Sequence
- VNKEIFTGGRTGDFMDIEQNISNIRASLPEGVKLVAVSKFHPVESIKKAYEAGQRIFGESRVQELTAKQPVLPEDIEWHFIGTLQTNKVRHIAPFISMIQSVDTLKLLQEINRQAAKCNRTAIRVLIEVHIAEEAGKHGFSVDETNALFTGDALRQFPCIRVCGLMGMATFTDSTDRVRREFGLLRHLFEAIKSVPFPGRDFFTELSMGMSDDYQPAVEEGSTMVRIGTGIFGTRPY
Sample Types
Isolate
7.6%
Metagenome
92.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
27.5%
Termitidae
27.5%
Blattidae
13.7%
Unclassified
9.8%
Formicidae
5.9%
Termopsidae
5.9%
Passalidae
3.9%
Rhinotermitidae
3.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 2 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 3 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 4 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 5 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 6 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 7 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 8 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 9 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 10 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 11 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 12 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 13 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 16 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 17 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 18 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 19 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 20 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 33 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 45 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 49 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 50 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 51 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466704_066322 | 3300042643 | Bacteria | 6299 |
| 2 | Ga0466704_131161 | 3300042643 | Bacteria | 4212 |
| 3 | Ga0466727_095384 | 3300042655 | Bacteria | 2834 |
| 4 | Ga0466727_267683 | 3300042655 | Bacteria | 8892 |
| 5 | Ga0466713_115951 | 3300042602 | Bacteria | 13432 |
| 6 | Ga0466656_314350 | 3300042550 | Bacteria | 1659 |
| 7 | Ga0466691_060905 | 3300042593 | Bacteria | 24431 |
| 8 | Ga0466696_353529 | 3300042596 | Bacteria | 7911 |
| 9 | Ga0466711_159353 | 3300042615 | Bacteria | 25904 |
| 10 | Ga0466723_079433 | 3300042618 | Bacteria | 22184 |
| 11 | Ga0466726_328170 | 3300042619 | Bacteria | 2661 |
| 12 | Ga0466729_009735 | 3300042621 | Bacteria | 22167 |
| 13 | Ga0068305_10403683 | 3300005083 | Bacteria | 4814 |
| 14 | Ga0466727_134542 | 3300042655 | Bacteria | 20406 |
| 15 | Ga0466706_019161 | 3300042599 | Bacteria | 8225 |
| 16 | Ga0466713_111518 | 3300042602 | Bacteria | 24866 |
| 17 | Ga0466695_253440 | 3300042595 | Unclassified | 2744 |
| 18 | Ga0466696_186658 | 3300042596 | Bacteria | 14592 |
| 19 | Ga0466712_169726 | 3300042614 | Bacteria | 1143 |
| 20 | Ga0466711_143692 | 3300042615 | Bacteria | 9063 |
| 21 | Ga0466715_364435 | 3300042616 | Bacteria | 27534 |
| 22 | IMNBL1DRAFT_c0013732 | 3300000062 | Bacteria | 3610 |
| 23 | JGI24702J35022_10200913 | 3300002462 | Bacteria | 1141 |
| 24 | Ga0103265_1000184 | 3300007068 | Bacteria | 9844 |
| 25 | Ga0466733_176289 | 3300042659 | Bacteria | 1009 |
| 26 | Ga0466703_027261 | 3300042636 | Bacteria | 7046 |
| 27 | Ga0466704_602528 | 3300042643 | Bacteria | 2233 |
| 28 | Ga0466725_013960 | 3300042654 | Bacteria | 4139 |
| 29 | Ga0466727_046012 | 3300042655 | Bacteria | 12350 |
| 30 | Ga0466698_307937 | 3300042610 | Bacteria | 2856 |
| 31 | Ga0123355_10004769 | 3300009826 | Bacteria | 19733 |
| 32 | Ga0265387_1009807 | 3300024582 | Bacteria | 1299 |
| 33 | Ga0466657_161233 | 3300042582 | Bacteria | 5200 |
| 34 | Ga0466696_035519 | 3300042596 | Bacteria | 1237 |
| 35 | Ga0466705_419050 | 3300042612 | Bacteria | 11402 |
| 36 | Ga0466711_043128 | 3300042615 | Bacteria | 56831 |
| 37 | Ga0466715_515941 | 3300042616 | Bacteria | 8796 |
| 38 | Ga0466723_023805 | 3300042618 | Bacteria | 54844 |
| 39 | JGI24702J35022_10008518 | 3300002462 | Bacteria | 5804 |
| 40 | JGI24702J35022_10030848 | 3300002462 | Bacteria | 2875 |
| 41 | Ga0068305_10260006 | 3300005083 | Unclassified | 3626 |
| 42 | Ga0466705_254631 | 3300042612 | Bacteria | 3114 |
| 43 | Ga0466730_018776 | 3300042625 | Bacteria | 1798 |
| 44 | Ga0466703_030867 | 3300042636 | Bacteria | 3231 |
| 45 | Ga0466704_389238 | 3300042643 | Unclassified | 3013 |
| 46 | Ga0466704_486727 | 3300042643 | Bacteria | 13716 |
| 47 | Ga0466713_094343 | 3300042602 | Bacteria | 28200 |
| 48 | Ga0466696_136838 | 3300042596 | Bacteria | 2511 |
| 49 | Ga0466696_220572 | 3300042596 | Bacteria | 15855 |
| 50 | Ga0466711_391486 | 3300042615 | Bacteria | 11141 |
| 51 | Ga0466715_358298 | 3300042616 | Bacteria | 8462 |
| 52 | Ga0466715_364214 | 3300042616 | Bacteria | 11559 |
| 53 | Ga0466715_485052 | 3300042616 | Bacteria | 31199 |
| 54 | 2227391938 | 2225789004 | Bacteria | 5834 |
| 55 | JGI24702J35022_10242131 | 3300002462 | Bacteria | 1046 |
| 56 | JGI24699J35502_11134228 | 3300002509 | Bacteria | 91082 |
| 57 | Ga0466733_079953 | 3300042659 | Bacteria | 3066 |
| 58 | Ga0466733_162571 | 3300042659 | Bacteria | 74751 |
| 59 | Ga0466735_231536 | 3300042624 | Bacteria | 1653 |
| 60 | Ga0466709_054618 | 3300042648 | Bacteria | 102226 |
| 61 | Ga0466727_263308 | 3300042655 | Bacteria | 66130 |
| 62 | Ga0466707_357420 | 3300042601 | Bacteria | 4417 |
| 63 | Ga0466713_142294 | 3300042602 | Bacteria | 9671 |
| 64 | Ga0466690_336420 | 3300042590 | Bacteria | 10674 |
| 65 | Ga0466696_163360 | 3300042596 | Bacteria | 29150 |
| 66 | Ga0466705_422867 | 3300042612 | Bacteria | 3246 |
| 67 | Ga0466705_523645 | 3300042612 | Bacteria | 11515 |
| 68 | 2227560738 | 2225789004 | Bacteria | 14473 |
| 69 | Ga0068305_10102506 | 3300005083 | Bacteria | 10264 |
| 70 | Ga0466733_116238 | 3300042659 | Bacteria | 23750 |
| 71 | Ga0466703_087213 | 3300042636 | Bacteria | 7693 |
| 72 | Ga0466704_304394 | 3300042643 | Bacteria | 14547 |
| 73 | Ga0466708_190382 | 3300042652 | Bacteria | 2558 |
| 74 | Ga0466725_201989 | 3300042654 | Bacteria | 20545 |
| 75 | Ga0466713_123886 | 3300042602 | Bacteria | 17149 |
| 76 | Ga0466716_181858 | 3300042605 | Bacteria | 10465 |
| 77 | Ga0466716_506818 | 3300042605 | Bacteria | 7808 |
| 78 | Ga0466719_178975 | 3300042606 | Bacteria | 12303 |
| 79 | Ga0123354_10183185 | 3300010882 | Bacteria | 2381 |
| 80 | Ga0466657_118786 | 3300042582 | Bacteria | 1315 |
| 81 | Ga0466696_131478 | 3300042596 | Bacteria | 1689 |
| 82 | Ga0466705_435270 | 3300042612 | Bacteria | 1695 |
| 83 | Ga0466711_143498 | 3300042615 | Bacteria | 2790 |
| 84 | Ga0466723_099062 | 3300042618 | Bacteria | 4955 |
| 85 | Ga0466726_019634 | 3300042619 | Bacteria | 8592 |
| 86 | Ga0466728_022023 | 3300042620 | Bacteria | 23716 |
| 87 | JGI24702J35022_10000190 | 3300002462 | Bacteria | 32930 |
| 88 | JGI24702J35022_10071135 | 3300002462 | Bacteria | 1873 |
| 89 | Ga0466735_056566 | 3300042624 | Bacteria | 15167 |
| 90 | Ga0466735_155545 | 3300042624 | Bacteria | 1198 |
| 91 | Ga0466703_086970 | 3300042636 | Bacteria | 15652 |
| 92 | Ga0466703_295476 | 3300042636 | Bacteria | 3820 |
| 93 | Ga0466703_353504 | 3300042636 | Bacteria | 1716 |
| 94 | Ga0466704_050220 | 3300042643 | Bacteria | 8094 |
| 95 | Ga0466704_123580 | 3300042643 | Bacteria | 5942 |
| 96 | Ga0466704_346326 | 3300042643 | Bacteria | 12308 |
| 97 | Ga0466707_220310 | 3300042601 | Bacteria | 2307 |
| 98 | Ga0466719_525073 | 3300042606 | Bacteria | 16045 |
| 99 | Ga0123356_11343388 | 3300010049 | Bacteria | 877 |
| 100 | Ga0466690_239745 | 3300042590 | Bacteria | 5963 |
| 101 | Ga0466726_224783 | 3300042619 | Bacteria | 3155 |
| 102 | Ga0466728_070459 | 3300042620 | Bacteria | 23231 |
| 103 | IMNBL1DRAFT_c0000891 | 3300000062 | Bacteria | 23227 |
| 104 | Ga0068305_10015353 | 3300005083 | Bacteria | 31632 |
| 105 | Ga0068305_10173207 | 3300005083 | Bacteria | 2350 |
| 106 | Ga0466705_033719 | 3300042612 | Bacteria | 6422 |
| 107 | Ga0466733_123170 | 3300042659 | Bacteria | 64337 |
| 108 | Ga0466733_184512 | 3300042659 | Bacteria | 15902 |
| 109 | Ga0466703_075829 | 3300042636 | Bacteria | 11636 |
| 110 | Ga0466704_058431 | 3300042643 | Bacteria | 15073 |
| 111 | Ga0466709_072602 | 3300042648 | Bacteria | 4014 |
| 112 | Ga0466709_099822 | 3300042648 | Bacteria | 2618 |
| 113 | Ga0466701_085222 | 3300042598 | Bacteria | 1121 |
| 114 | Ga0466706_163906 | 3300042599 | Bacteria | 105365 |
| 115 | Ga0466716_370868 | 3300042605 | Bacteria | 19469 |
| 116 | Ga0466696_201308 | 3300042596 | Bacteria | 12143 |
| 117 | 2227203598 | 2225789004 | Bacteria | 1432 |
| 118 | 2227604076 | 2225789004 | Bacteria | 2312 |
| 119 | IMNBL1DRAFT_c0002288 | 3300000062 | Bacteria | 13463 |
| 120 | Ga0068305_10058946 | 3300005083 | Bacteria | 3403 |
| 121 | Ga0102734_1000413 | 3300007129 | Bacteria | 12226 |
| 122 | Ga0102737_1000082 | 3300007142 | Bacteria | 29181 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01168 | Ala_racemase_N | Alanine racemase, N-terminal domain | 16 | 236 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.