Protein Family IF09524
Metagenome
Isolate
354
Members
106
Samples
303
Scaffolds
576.27
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_500708|Ga0466704_500708_10105_12018
- Length
- 637 aa
- Sequence
- VGIPQEWIKSALKSRAGNCYNRICPKRGPRPAADPVKNMPHQAKRNFNISPLRVFASYYRPHWKLFAADMFCALLISAVDLVFPMLTRYTLEKLLGQNLLRLFVCVVALMVFIYILRLCFSFFVTYWGHTVGTYIEADMRRDLFNHLQELPFSFYDNHRTGHIMSRVTTDLFEVTELAHHGPEDLFISVLTLSGSFILIVTIRWELAXXXVVMIPLFVIHIAFSRRRLMAVSRKVKERTAEINASLESSISGVRVAKAFTNENYEAEKFSAGNESFKLARKGYYRAMAFFHSKIEFMNSILMVTVVAAGGFLIMRGRMNLADLVACNLFVAAFLQPIRRLQNFVEQFTTGMAGFLRFLEIMRMESDITDREGAARLENVRGNISYNDVTFSYFKKTRDADAASDKKQKHCVLDHISLTVPAGSTTALVGPSGGGKTTLCHLLPRFYETSGGSITIDGVDIRNFTLVSLRGNIGIVQQDVFLFAGTIGENIGYGRIGAADSEIIEAAKQAEIHEDILRMPAGYDTPVGERGIKLSGGQKQRVSIARIFLKNPPILILDEATSALDTATEQKIQRAFEKLSRGRTTLIIAHRLSTVRNAGNIIVLGDRGILQRGRHEELLAEGGLYADLYKAQFKPYKL
Sample Types
Isolate
14.4%
Metagenome
85.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
24.0%
Termitidae
22.1%
Kalotermitidae
13.5%
Blattidae
12.5%
Termopsidae
3.8%
Rhinotermitidae
3.8%
Curculionidae
2.9%
Passalidae
2.9%
Tenebrionidae
1.9%
Stratiomyidae
1.9%
Scarabaeidae
1.0%
Pyrrhocoridae
1.0%
Euphausiidae
1.0%
Dytiscidae
1.0%
Drosophilidae
1.0%
Hodotermitidae
1.0%
Elmidae
1.0%
Blaberidae
1.0%
Penaeidae
1.0%
Formicidae
1.0%
Apidae
1.0%
Taxonomy
Archaea
0
Bacteria
338
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 2 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 3 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 4 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 5 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 6 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 7 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 8 | 2820441105 | Unclassified Firmicutes Lab288P3bin202 | Isolate | Unclassified |
| 9 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 17 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 18 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 19 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 20 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 23 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 29 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 30 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 31 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 32 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 35 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 36 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 37 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 38 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 39 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 40 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 41 | 2820727601 | Unclassified Cloacimonetes Nt197P3bin46 | Isolate | Unclassified |
| 42 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 45 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 48 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 49 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 52 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 53 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 54 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 55 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 56 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 57 | 2820526825 | Unclassified Firmicutes Lab288P1bin16 | Isolate | Unclassified |
| 58 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 59 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 60 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 61 | 2989426036 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 62 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 63 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 64 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 65 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 66 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 67 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 68 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 69 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 70 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 71 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 72 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 73 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 74 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 75 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 76 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 77 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 78 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 79 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 80 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 81 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 82 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 83 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 84 | 8118997823 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 85 | 2820942695 | Unclassified Actinobacteria Cu122P5bin37 | Isolate | Unclassified |
| 86 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 87 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 88 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 89 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 90 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 91 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 92 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 93 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 94 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 95 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 96 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 97 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 98 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 99 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 100 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 101 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 102 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 103 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 104 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 105 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 106 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_211733 | 3300042614 | Bacteria | 14928 |
| 2 | Ga0466715_360565 | 3300042616 | Bacteria | 19870 |
| 3 | Ga0466723_033010 | 3300042618 | Bacteria | 16420 |
| 4 | Ga0466723_094588 | 3300042618 | Bacteria | 5086 |
| 5 | Ga0466723_124748 | 3300042618 | Bacteria | 48807 |
| 6 | Ga0466726_180726 | 3300042619 | Bacteria | 1703 |
| 7 | Ga0466728_293317 | 3300042620 | Bacteria | 9147 |
| 8 | Ga0123357_10149558 | 3300009784 | Bacteria | 2839 |
| 9 | Ga0123355_10000930 | 3300009826 | Bacteria | 40484 |
| 10 | 2227666273 | 2225789004 | Bacteria | 10384 |
| 11 | IMNBL1DRAFT_c0001042 | 3300000062 | Bacteria | 21469 |
| 12 | IMNBL1DRAFT_c0007117 | 3300000062 | Bacteria | 5952 |
| 13 | JGI24700J35501_10930927 | 3300002508 | Bacteria | 55016 |
| 14 | Ga0068305_10003083 | 3300005083 | Bacteria | 74883 |
| 15 | Ga0466691_015774 | 3300042593 | Bacteria | 8998 |
| 16 | Ga0466691_029694 | 3300042593 | Unclassified | 2705 |
| 17 | Ga0466705_077787 | 3300042612 | Bacteria | 10147 |
| 18 | Ga0466703_148217 | 3300042636 | Bacteria | 7222 |
| 19 | Ga0466703_156601 | 3300042636 | Bacteria | 19933 |
| 20 | Ga0466704_485010 | 3300042643 | Bacteria | 28400 |
| 21 | Ga0466704_551304 | 3300042643 | Bacteria | 2277 |
| 22 | Ga0466709_116497 | 3300042648 | Bacteria | 7086 |
| 23 | Ga0466709_212564 | 3300042648 | Bacteria | 13118 |
| 24 | Ga0466708_010546 | 3300042652 | Bacteria | 5993 |
| 25 | Ga0466708_081596 | 3300042652 | Bacteria | 3505 |
| 26 | Ga0466708_242308 | 3300042652 | Bacteria | 14613 |
| 27 | Ga0466722_012195 | 3300042609 | Bacteria | 4696 |
| 28 | Ga0466722_201400 | 3300042609 | Bacteria | 6111 |
| 29 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 30 | Ga0466715_068479 | 3300042616 | Bacteria | 6526 |
| 31 | Ga0466715_110172 | 3300042616 | Bacteria | 5400 |
| 32 | Ga0466715_325419 | 3300042616 | Bacteria | 14030 |
| 33 | Ga0466715_328847 | 3300042616 | Bacteria | 61256 |
| 34 | Ga0466723_131866 | 3300042618 | Bacteria | 19893 |
| 35 | Ga0466723_198078 | 3300042618 | Bacteria | 2877 |
| 36 | Ga0123355_10014087 | 3300009826 | Bacteria | 12475 |
| 37 | Ga0123356_10034471 | 3300010049 | Bacteria | 4730 |
| 38 | Ga0123353_10006459 | 3300010167 | Bacteria | 15604 |
| 39 | Ga0123353_10159262 | 3300010167 | Bacteria | 3595 |
| 40 | IMNBL1DRAFT_c0000005 | 3300000062 | Bacteria | 248552 |
| 41 | IMNBL1DRAFT_c0010355 | 3300000062 | Bacteria | 4479 |
| 42 | JGI24703J35330_11748621 | 3300002501 | Bacteria | 22438 |
| 43 | Ga0072941_1072940 | 3300005201 | Bacteria | 6177 |
| 44 | Ga0466690_146851 | 3300042590 | Bacteria | 110739 |
| 45 | Ga0466692_124797 | 3300042591 | Bacteria | 10415 |
| 46 | Ga0466691_175106 | 3300042593 | Bacteria | 13132 |
| 47 | Ga0466696_005173 | 3300042596 | Bacteria | 9888 |
| 48 | Ga0466705_278952 | 3300042612 | Bacteria | 5430 |
| 49 | Ga0466705_286184 | 3300042612 | Bacteria | 8385 |
| 50 | Ga0466703_084988 | 3300042636 | Bacteria | 37482 |
| 51 | Ga0466703_181012 | 3300042636 | Bacteria | 22339 |
| 52 | Ga0466703_203122 | 3300042636 | Bacteria | 7939 |
| 53 | Ga0466703_261229 | 3300042636 | Bacteria | 7155 |
| 54 | Ga0466704_026298 | 3300042643 | Bacteria | 3743 |
| 55 | Ga0466709_005444 | 3300042648 | Bacteria | 2280 |
| 56 | Ga0466708_007204 | 3300042652 | Bacteria | 2241 |
| 57 | Ga0466708_181435 | 3300042652 | Bacteria | 4618 |
| 58 | Ga0466706_148803 | 3300042599 | Bacteria | 11975 |
| 59 | Ga0466707_353377 | 3300042601 | Bacteria | 105005 |
| 60 | Ga0466713_017270 | 3300042602 | Bacteria | 126285 |
| 61 | Ga0466713_142256 | 3300042602 | Unclassified | 27489 |
| 62 | Ga0466719_348214 | 3300042606 | Bacteria | 3356 |
| 63 | Ga0466722_238539 | 3300042609 | Bacteria | 3290 |
| 64 | Ga0466712_187668 | 3300042614 | Bacteria | 25579 |
| 65 | Ga0466712_214134 | 3300042614 | Bacteria | 4469 |
| 66 | Ga0466711_032949 | 3300042615 | Bacteria | 3152 |
| 67 | Ga0466711_413936 | 3300042615 | Bacteria | 12913 |
| 68 | Ga0466711_435117 | 3300042615 | Bacteria | 6205 |
| 69 | Ga0466715_428033 | 3300042616 | Bacteria | 3624 |
| 70 | Ga0466723_160913 | 3300042618 | Bacteria | 32817 |
| 71 | Ga0466723_174351 | 3300042618 | Bacteria | 3457 |
| 72 | Ga0466723_238119 | 3300042618 | Bacteria | 10350 |
| 73 | Ga0466726_230209 | 3300042619 | Bacteria | 1888 |
| 74 | Ga0466728_023717 | 3300042620 | Bacteria | 4269 |
| 75 | Ga0123355_10013554 | 3300009826 | Bacteria | 12698 |
| 76 | Ga0123356_10000490 | 3300010049 | Bacteria | 44075 |
| 77 | Ga0123353_10047776 | 3300010167 | Bacteria | 6810 |
| 78 | IMNBL1DRAFT_c0000021 | 3300000062 | Bacteria | 148886 |
| 79 | Ga0072941_1001734 | 3300005201 | Bacteria | 34764 |
| 80 | Ga0123357_10000067 | 3300009784 | Bacteria | 84688 |
| 81 | Ga0160452_100068 | 3300012834 | Bacteria | 140253 |
| 82 | Ga0456237_0000792 | 3300041968 | Bacteria | 4907 |
| 83 | Ga0466690_061675 | 3300042590 | Unclassified | 2839 |
| 84 | Ga0466690_243554 | 3300042590 | Bacteria | 43818 |
| 85 | Ga0466691_094213 | 3300042593 | Bacteria | 7921 |
| 86 | Ga0466696_294748 | 3300042596 | Bacteria | 2439 |
| 87 | Ga0466696_336189 | 3300042596 | Bacteria | 13799 |
| 88 | Ga0466705_058418 | 3300042612 | Unclassified | 7048 |
| 89 | Ga0466705_194577 | 3300042612 | Bacteria | 2306 |
| 90 | Ga0466704_051116 | 3300042643 | Bacteria | 38647 |
| 91 | Ga0466704_079971 | 3300042643 | Bacteria | 7652 |
| 92 | Ga0466709_135527 | 3300042648 | Bacteria | 31176 |
| 93 | Ga0466709_307488 | 3300042648 | Bacteria | 38952 |
| 94 | Ga0466707_064723 | 3300042601 | Bacteria | 2534 |
| 95 | Ga0466707_247506 | 3300042601 | Bacteria | 4201 |
| 96 | Ga0466714_031987 | 3300042603 | Bacteria | 4677 |
| 97 | Ga0466716_009812 | 3300042605 | Bacteria | 7063 |
| 98 | Ga0466719_013039 | 3300042606 | Bacteria | 13418 |
| 99 | Ga0466719_238818 | 3300042606 | Bacteria | 2004 |
| 100 | Ga0466719_513423 | 3300042606 | Bacteria | 10568 |
| 101 | Ga0466722_047262 | 3300042609 | Bacteria | 44133 |
| 102 | Ga0466722_082170 | 3300042609 | Bacteria | 7796 |
| 103 | Ga0466711_136877 | 3300042615 | Bacteria | 36292 |
| 104 | Ga0466711_401874 | 3300042615 | Bacteria | 14305 |
| 105 | Ga0466715_087961 | 3300042616 | Bacteria | 17232 |
| 106 | Ga0466715_262210 | 3300042616 | Bacteria | 35550 |
| 107 | Ga0466723_220532 | 3300042618 | Bacteria | 7285 |
| 108 | Ga0466726_316944 | 3300042619 | Bacteria | 2991 |
| 109 | Ga0466728_156011 | 3300042620 | Bacteria | 2454 |
| 110 | Ga0123353_10003115 | 3300010167 | Bacteria | 20798 |
| 111 | 2212191336 | 2209111004 | Bacteria | 10245 |
| 112 | IMNBL1DRAFT_c0005883 | 3300000062 | Bacteria | 6871 |
| 113 | IMNBL1DRAFT_c0008100 | 3300000062 | Bacteria | 5407 |
| 114 | JGI24696J40584_12960224 | 3300002834 | Bacteria | 6657 |
| 115 | Ga0072940_1065051 | 3300005200 | Bacteria | 2213 |
| 116 | Ga0415639_048024 | 3300038395 | Bacteria | 8483 |
| 117 | Ga0466692_204783 | 3300042591 | Bacteria | 4721 |
| 118 | Ga0466691_009903 | 3300042593 | Bacteria | 4675 |
| 119 | Ga0466691_162483 | 3300042593 | Bacteria | 4111 |
| 120 | Ga0466696_026170 | 3300042596 | Bacteria | 2007 |
| 121 | Ga0466705_236504 | 3300042612 | Bacteria | 2736 |
| 122 | Ga0466703_247142 | 3300042636 | Bacteria | 96407 |
| 123 | Ga0466703_308976 | 3300042636 | Bacteria | 12468 |
| 124 | Ga0466704_077768 | 3300042643 | Bacteria | 26239 |
| 125 | Ga0466704_500708 | 3300042643 | Bacteria | 15237 |
| 126 | Ga0466709_074673 | 3300042648 | Bacteria | 10044 |
| 127 | Ga0466706_038765 | 3300042599 | Bacteria | 36318 |
| 128 | Ga0466713_112738 | 3300042602 | Bacteria | 100011 |
| 129 | Ga0466713_129417 | 3300042602 | Bacteria | 66756 |
| 130 | Ga0466717_154236 | 3300042604 | Bacteria | 4214 |
| 131 | Ga0466716_210240 | 3300042605 | Bacteria | 36809 |
| 132 | Ga0466719_009138 | 3300042606 | Bacteria | 3952 |
| 133 | Ga0466719_159024 | 3300042606 | Bacteria | 18310 |
| 134 | Ga0466719_368694 | 3300042606 | Bacteria | 3116 |
| 135 | Ga0466722_230538 | 3300042609 | Bacteria | 16030 |
| 136 | Ga0466715_217434 | 3300042616 | Bacteria | 17308 |
| 137 | Ga0466715_326145 | 3300042616 | Bacteria | 37884 |
| 138 | Ga0466718_087814 | 3300042617 | Bacteria | 3615 |
| 139 | Ga0466723_009675 | 3300042618 | Bacteria | 2820 |
| 140 | Ga0466723_063701 | 3300042618 | Bacteria | 28262 |
| 141 | Ga0466723_205772 | 3300042618 | Bacteria | 8872 |
| 142 | Ga0123353_10047781 | 3300010167 | Bacteria | 6810 |
| 143 | Ga0123353_10147181 | 3300010167 | Bacteria | 3765 |
| 144 | Ga0123354_10001235 | 3300010882 | Bacteria | 30314 |
| 145 | Ga0123354_10039399 | 3300010882 | Bacteria | 7325 |
| 146 | DPOL_contig13995 | 2035918003 | Bacteria | 69230 |
| 147 | IMNBL1DRAFT_c0001151 | 3300000062 | Bacteria | 20195 |
| 148 | IMNBL1DRAFT_c0014156 | 3300000062 | Bacteria | 3539 |
| 149 | JGI24698J34947_10000782 | 3300002449 | Bacteria | 15804 |
| 150 | JGI24702J35022_10009560 | 3300002462 | Bacteria | 5435 |
| 151 | Ga0063521_1001253 | 3300003973 | Unclassified | 7328 |
| 152 | Ga0466690_182750 | 3300042590 | Bacteria | 24839 |
| 153 | Ga0466690_421764 | 3300042590 | Bacteria | 5067 |
| 154 | Ga0466696_285136 | 3300042596 | Bacteria | 11592 |
| 155 | Ga0466696_361474 | 3300042596 | Bacteria | 23704 |
| 156 | Ga0466705_363037 | 3300042612 | Bacteria | 9036 |
| 157 | Ga0466703_269166 | 3300042636 | Bacteria | 5155 |
| 158 | Ga0466703_270123 | 3300042636 | Unclassified | 3994 |
| 159 | Ga0466704_149197 | 3300042643 | Bacteria | 4785 |
| 160 | Ga0466704_153702 | 3300042643 | Bacteria | 14778 |
| 161 | Ga0466708_049312 | 3300042652 | Bacteria | 30228 |
| 162 | Ga0466725_092761 | 3300042654 | Bacteria | 6554 |
| 163 | Ga0466727_051911 | 3300042655 | Bacteria | 14691 |
| 164 | Ga0466719_324638 | 3300042606 | Bacteria | 8947 |
| 165 | Ga0466719_391887 | 3300042606 | Bacteria | 5353 |
| 166 | Ga0466722_025485 | 3300042609 | Bacteria | 59385 |
| 167 | Ga0466711_425720 | 3300042615 | Bacteria | 4754 |
| 168 | Ga0466711_471385 | 3300042615 | Bacteria | 2440 |
| 169 | Ga0466715_584313 | 3300042616 | Bacteria | 25336 |
| 170 | Ga0466715_618225 | 3300042616 | Bacteria | 18057 |
| 171 | Ga0466723_021437 | 3300042618 | Bacteria | 14514 |
| 172 | Ga0466723_059959 | 3300042618 | Bacteria | 1976 |
| 173 | Ga0466726_196658 | 3300042619 | Bacteria | 4903 |
| 174 | Ga0466726_316888 | 3300042619 | Bacteria | 11804 |
| 175 | Ga0466726_472750 | 3300042619 | Bacteria | 2490 |
| 176 | Ga0123357_10021315 | 3300009784 | Bacteria | 8676 |
| 177 | Ga0123356_10198904 | 3300010049 | Bacteria | 2042 |
| 178 | Ga0123353_10169058 | 3300010167 | Bacteria | 3472 |
| 179 | 2227194707 | 2225789004 | Bacteria | 7841 |
| 180 | 2227566312 | 2225789004 | Bacteria | 14111 |
| 181 | 2227619063 | 2225789004 | Bacteria | 44654 |
| 182 | JGI24698J34947_10000897 | 3300002449 | Unclassified | 15086 |
| 183 | JGI24698J34947_10002027 | 3300002449 | Bacteria | 10801 |
| 184 | Ga0466690_007442 | 3300042590 | Unclassified | 7395 |
| 185 | Ga0466691_029705 | 3300042593 | Bacteria | 33995 |
| 186 | Ga0466691_126270 | 3300042593 | Bacteria | 2047 |
| 187 | Ga0466694_052783 | 3300042594 | Bacteria | 9647 |
| 188 | Ga0466735_018679 | 3300042624 | Bacteria | 1715 |
| 189 | Ga0466735_105285 | 3300042624 | Bacteria | 10897 |
| 190 | Ga0466703_200348 | 3300042636 | Bacteria | 25667 |
| 191 | Ga0466703_423403 | 3300042636 | Bacteria | 132694 |
| 192 | Ga0466704_146260 | 3300042643 | Bacteria | 3032 |
| 193 | Ga0466704_240234 | 3300042643 | Bacteria | 65177 |
| 194 | Ga0466704_274968 | 3300042643 | Bacteria | 1681 |
| 195 | Ga0466708_082101 | 3300042652 | Bacteria | 6650 |
| 196 | Ga0466708_269645 | 3300042652 | Bacteria | 39521 |
| 197 | Ga0466708_389147 | 3300042652 | Bacteria | 12512 |
| 198 | Ga0466707_110720 | 3300042601 | Bacteria | 3207 |
| 199 | Ga0466707_220554 | 3300042601 | Bacteria | 7006 |
| 200 | Ga0466707_327546 | 3300042601 | Bacteria | 2019 |
| 201 | Ga0466707_409948 | 3300042601 | Unclassified | 14484 |
| 202 | Ga0466713_025223 | 3300042602 | Bacteria | 106972 |
| 203 | Ga0466719_025873 | 3300042606 | Bacteria | 4139 |
| 204 | Ga0466719_104467 | 3300042606 | Bacteria | 52022 |
| 205 | Ga0562378_0723 | 3300056814 | Bacteria | 47258 |
| 206 | Ga0466705_511634 | 3300042612 | Bacteria | 2045 |
| 207 | Ga0466712_169729 | 3300042614 | Bacteria | 7955 |
| 208 | Ga0466711_415843 | 3300042615 | Bacteria | 7247 |
| 209 | Ga0466715_117998 | 3300042616 | Bacteria | 15687 |
| 210 | Ga0466715_366753 | 3300042616 | Bacteria | 6292 |
| 211 | Ga0466723_001218 | 3300042618 | Bacteria | 4977 |
| 212 | Ga0466723_007768 | 3300042618 | Bacteria | 2657 |
| 213 | Ga0466723_039166 | 3300042618 | Bacteria | 11955 |
| 214 | Ga0466723_075173 | 3300042618 | Bacteria | 100663 |
| 215 | Ga0466723_274630 | 3300042618 | Bacteria | 2526 |
| 216 | Ga0466726_017894 | 3300042619 | Bacteria | 11731 |
| 217 | Ga0466726_146211 | 3300042619 | Bacteria | 14691 |
| 218 | Ga0466726_249259 | 3300042619 | Bacteria | 4653 |
| 219 | Ga0466726_308063 | 3300042619 | Bacteria | 4786 |
| 220 | Ga0466728_242957 | 3300042620 | Bacteria | 11208 |
| 221 | Ga0466729_124679 | 3300042621 | Bacteria | 47965 |
| 222 | Ga0123353_10000251 | 3300010167 | Bacteria | 67704 |
| 223 | Ga0123353_10277368 | 3300010167 | Bacteria | 2577 |
| 224 | 2227067746 | 2225789003 | Unclassified | 3055 |
| 225 | IMNBL1DRAFT_c0001449 | 3300000062 | Bacteria | 17740 |
| 226 | IMNBL1DRAFT_c0008762 | 3300000062 | Bacteria | 5103 |
| 227 | JGI24698J34947_10000153 | 3300002449 | Bacteria | 26364 |
| 228 | Ga0072941_1025326 | 3300005201 | Unclassified | 10993 |
| 229 | Ga0466690_343702 | 3300042590 | Bacteria | 2510 |
| 230 | Ga0466691_119073 | 3300042593 | Bacteria | 8604 |
| 231 | Ga0466691_150133 | 3300042593 | Bacteria | 24134 |
| 232 | Ga0466691_197795 | 3300042593 | Unclassified | 5842 |
| 233 | Ga0466696_171103 | 3300042596 | Bacteria | 5300 |
| 234 | Ga0466696_228153 | 3300042596 | Bacteria | 3463 |
| 235 | Ga0466701_005562 | 3300042598 | Bacteria | 41288 |
| 236 | Ga0466705_175538 | 3300042612 | Bacteria | 4607 |
| 237 | Ga0466705_301803 | 3300042612 | Unclassified | 3090 |
| 238 | Ga0466735_203996 | 3300042624 | Bacteria | 3894 |
| 239 | Ga0466703_353397 | 3300042636 | Bacteria | 3671 |
| 240 | Ga0466704_153841 | 3300042643 | Bacteria | 7684 |
| 241 | Ga0466704_315544 | 3300042643 | Bacteria | 6621 |
| 242 | Ga0466704_330894 | 3300042643 | Bacteria | 161855 |
| 243 | Ga0466704_576894 | 3300042643 | Bacteria | 14984 |
| 244 | Ga0466709_292242 | 3300042648 | Bacteria | 5598 |
| 245 | Ga0466708_032132 | 3300042652 | Bacteria | 55974 |
| 246 | Ga0466708_462836 | 3300042652 | Bacteria | 12811 |
| 247 | Ga0466727_053683 | 3300042655 | Bacteria | 5100 |
| 248 | Ga0466727_296831 | 3300042655 | Bacteria | 11310 |
| 249 | Ga0466706_009677 | 3300042599 | Bacteria | 7829 |
| 250 | Ga0466706_258120 | 3300042599 | Bacteria | 3715 |
| 251 | Ga0466707_147316 | 3300042601 | Bacteria | 5311 |
| 252 | Ga0466707_226450 | 3300042601 | Bacteria | 25110 |
| 253 | Ga0466713_154958 | 3300042602 | Bacteria | 2261 |
| 254 | Ga0466719_109850 | 3300042606 | Bacteria | 3396 |
| 255 | Ga0466719_309054 | 3300042606 | Bacteria | 10018 |
| 256 | Ga0466719_576478 | 3300042606 | Bacteria | 13470 |
| 257 | Ga0466705_443092 | 3300042612 | Bacteria | 12953 |
| 258 | Ga0466712_315952 | 3300042614 | Bacteria | 13064 |
| 259 | Ga0466711_391393 | 3300042615 | Bacteria | 5112 |
| 260 | Ga0466715_099135 | 3300042616 | Bacteria | 29293 |
| 261 | Ga0466715_247405 | 3300042616 | Bacteria | 4400 |
| 262 | Ga0466715_291567 | 3300042616 | Bacteria | 2469 |
| 263 | Ga0466723_032171 | 3300042618 | Unclassified | 6060 |
| 264 | Ga0466723_064587 | 3300042618 | Bacteria | 2824 |
| 265 | Ga0466723_290929 | 3300042618 | Bacteria | 5591 |
| 266 | Ga0466726_124077 | 3300042619 | Bacteria | 25543 |
| 267 | Ga0466728_104858 | 3300042620 | Bacteria | 2430 |
| 268 | Ga0466728_359048 | 3300042620 | Bacteria | 6298 |
| 269 | Ga0123355_10313050 | 3300009826 | Bacteria | 2125 |
| 270 | 2227364140 | 2225789004 | Bacteria | 6076 |
| 271 | 2227496845 | 2225789004 | Bacteria | 19985 |
| 272 | JGI24698J34947_10004192 | 3300002449 | Bacteria | 7835 |
| 273 | JGI24702J35022_10000780 | 3300002462 | Bacteria | 19744 |
| 274 | Ga0063521_1000294 | 3300003973 | Unclassified | 30808 |
| 275 | Ga0068302_10129852 | 3300005071 | Bacteria | 2349 |
| 276 | Ga0072941_1055611 | 3300005201 | Bacteria | 114377 |
| 277 | Ga0415639_021719 | 3300038395 | Bacteria | 4434 |
| 278 | Ga0466690_067238 | 3300042590 | Bacteria | 3359 |
| 279 | Ga0466690_108907 | 3300042590 | Bacteria | 2564 |
| 280 | Ga0466692_011894 | 3300042591 | Bacteria | 12750 |
| 281 | Ga0466691_048636 | 3300042593 | Bacteria | 17999 |
| 282 | Ga0466691_090857 | 3300042593 | Bacteria | 7763 |
| 283 | Ga0466691_118270 | 3300042593 | Bacteria | 14528 |
| 284 | Ga0466691_132996 | 3300042593 | Bacteria | 31181 |
| 285 | Ga0466696_016496 | 3300042596 | Bacteria | 5352 |
| 286 | Ga0466696_019763 | 3300042596 | Bacteria | 9088 |
| 287 | Ga0466735_178449 | 3300042624 | Unclassified | 1576 |
| 288 | Ga0466703_116528 | 3300042636 | Bacteria | 5807 |
| 289 | Ga0466703_312856 | 3300042636 | Bacteria | 8452 |
| 290 | Ga0466704_041925 | 3300042643 | Bacteria | 3026 |
| 291 | Ga0466704_125800 | 3300042643 | Bacteria | 10107 |
| 292 | Ga0466704_190087 | 3300042643 | Bacteria | 15645 |
| 293 | Ga0466704_247752 | 3300042643 | Bacteria | 43747 |
| 294 | Ga0466704_255186 | 3300042643 | Bacteria | 4914 |
| 295 | Ga0466709_328653 | 3300042648 | Bacteria | 8718 |
| 296 | Ga0466708_116940 | 3300042652 | Bacteria | 11921 |
| 297 | Ga0466708_238095 | 3300042652 | Bacteria | 3713 |
| 298 | Ga0466727_167529 | 3300042655 | Bacteria | 13631 |
| 299 | Ga0466713_029384 | 3300042602 | Bacteria | 7260 |
| 300 | Ga0466719_005088 | 3300042606 | Bacteria | 5363 |
| 301 | Ga0466719_091304 | 3300042606 | Bacteria | 3924 |
| 302 | Ga0466719_535056 | 3300042606 | Bacteria | 5962 |
| 303 | Ga0466722_168943 | 3300042609 | Bacteria | 8678 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.