Protein Family IF09524

Metagenome Isolate
354 Members
106 Samples
303 Scaffolds
576.27 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_500708|Ga0466704_500708_10105_12018
Length
637 aa
Sequence
VGIPQEWIKSALKSRAGNCYNRICPKRGPRPAADPVKNMPHQAKRNFNISPLRVFASYYRPHWKLFAADMFCALLISAVDLVFPMLTRYTLEKLLGQNLLRLFVCVVALMVFIYILRLCFSFFVTYWGHTVGTYIEADMRRDLFNHLQELPFSFYDNHRTGHIMSRVTTDLFEVTELAHHGPEDLFISVLTLSGSFILIVTIRWELAXXXVVMIPLFVIHIAFSRRRLMAVSRKVKERTAEINASLESSISGVRVAKAFTNENYEAEKFSAGNESFKLARKGYYRAMAFFHSKIEFMNSILMVTVVAAGGFLIMRGRMNLADLVACNLFVAAFLQPIRRLQNFVEQFTTGMAGFLRFLEIMRMESDITDREGAARLENVRGNISYNDVTFSYFKKTRDADAASDKKQKHCVLDHISLTVPAGSTTALVGPSGGGKTTLCHLLPRFYETSGGSITIDGVDIRNFTLVSLRGNIGIVQQDVFLFAGTIGENIGYGRIGAADSEIIEAAKQAEIHEDILRMPAGYDTPVGERGIKLSGGQKQRVSIARIFLKNPPILILDEATSALDTATEQKIQRAFEKLSRGRTTLIIAHRLSTVRNAGNIIVLGDRGILQRGRHEELLAEGGLYADLYKAQFKPYKL

πŸ“Š Sample Types

Isolate 14.4%
Metagenome 85.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 24.0%
Termitidae 22.1%
Kalotermitidae 13.5%
Blattidae 12.5%
Termopsidae 3.8%
Rhinotermitidae 3.8%
Curculionidae 2.9%
Passalidae 2.9%
Tenebrionidae 1.9%
Stratiomyidae 1.9%
Scarabaeidae 1.0%
Pyrrhocoridae 1.0%
Euphausiidae 1.0%
Dytiscidae 1.0%
Drosophilidae 1.0%
Hodotermitidae 1.0%
Elmidae 1.0%
Blaberidae 1.0%
Penaeidae 1.0%
Formicidae 1.0%
Apidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 338
Eukaryota 0
Viruses 0
Unclassified 16

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
2 2590828840 Clostridium sp. 2 Isolate Termitidae
3 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
4 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
5 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
6 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
7 2820533259 Unclassified Firmicutes Lab288P1bin140 Isolate Unclassified
8 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
14 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
15 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
16 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
17 2593339124 Clostridium sp. 4 Isolate Termitidae
18 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
19 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
20 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
23 8103002986 Erwinia sp. S38 Isolate Curculionidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
29 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
30 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
31 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
34 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
35 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
36 2821322763 Unclassified Actinobacteria Cu122P5bin19 Isolate Unclassified
37 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
38 2940349480 Fusobacterium sp. PH5-44 Isolate Blattidae
39 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
40 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
41 2820727601 Unclassified Cloacimonetes Nt197P3bin46 Isolate Unclassified
42 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
45 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
46 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
47 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
48 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
49 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
50 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
51 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
52 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
53 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
54 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
55 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
56 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
57 2820526825 Unclassified Firmicutes Lab288P1bin16 Isolate Unclassified
58 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
59 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
60 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
61 2989426036 Spiroplasma platyhelix PALS-1 Isolate Unclassified
62 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
63 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
64 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
65 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
66 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
67 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
68 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
69 2590828839 Clostridium sp. 1 Isolate Termitidae
70 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
71 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
72 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
73 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
74 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
75 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
76 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
77 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
78 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
79 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
80 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
81 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
82 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
83 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
84 8118997823 Spiroplasma platyhelix PALS-1 Isolate Unclassified
85 2820942695 Unclassified Actinobacteria Cu122P5bin37 Isolate Unclassified
86 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
87 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
88 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
89 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
90 2772190975 Treponema sp. RmG30 Isolate Blaberidae
91 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
92 650716102 Treponema primitia ZAS-2 Isolate Unclassified
93 8082023105 Niallia sp. Man26 Isolate Penaeidae
94 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
95 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
96 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
97 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
98 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
99 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
100 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
101 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
102 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
103 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
104 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
105 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
106 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_211733 3300042614 Bacteria 14928
2 Ga0466715_360565 3300042616 Bacteria 19870
3 Ga0466723_033010 3300042618 Bacteria 16420
4 Ga0466723_094588 3300042618 Bacteria 5086
5 Ga0466723_124748 3300042618 Bacteria 48807
6 Ga0466726_180726 3300042619 Bacteria 1703
7 Ga0466728_293317 3300042620 Bacteria 9147
8 Ga0123357_10149558 3300009784 Bacteria 2839
9 Ga0123355_10000930 3300009826 Bacteria 40484
10 2227666273 2225789004 Bacteria 10384
11 IMNBL1DRAFT_c0001042 3300000062 Bacteria 21469
12 IMNBL1DRAFT_c0007117 3300000062 Bacteria 5952
13 JGI24700J35501_10930927 3300002508 Bacteria 55016
14 Ga0068305_10003083 3300005083 Bacteria 74883
15 Ga0466691_015774 3300042593 Bacteria 8998
16 Ga0466691_029694 3300042593 Unclassified 2705
17 Ga0466705_077787 3300042612 Bacteria 10147
18 Ga0466703_148217 3300042636 Bacteria 7222
19 Ga0466703_156601 3300042636 Bacteria 19933
20 Ga0466704_485010 3300042643 Bacteria 28400
21 Ga0466704_551304 3300042643 Bacteria 2277
22 Ga0466709_116497 3300042648 Bacteria 7086
23 Ga0466709_212564 3300042648 Bacteria 13118
24 Ga0466708_010546 3300042652 Bacteria 5993
25 Ga0466708_081596 3300042652 Bacteria 3505
26 Ga0466708_242308 3300042652 Bacteria 14613
27 Ga0466722_012195 3300042609 Bacteria 4696
28 Ga0466722_201400 3300042609 Bacteria 6111
29 Ga0562377_0006 3300056842 Bacteria 3350072
30 Ga0466715_068479 3300042616 Bacteria 6526
31 Ga0466715_110172 3300042616 Bacteria 5400
32 Ga0466715_325419 3300042616 Bacteria 14030
33 Ga0466715_328847 3300042616 Bacteria 61256
34 Ga0466723_131866 3300042618 Bacteria 19893
35 Ga0466723_198078 3300042618 Bacteria 2877
36 Ga0123355_10014087 3300009826 Bacteria 12475
37 Ga0123356_10034471 3300010049 Bacteria 4730
38 Ga0123353_10006459 3300010167 Bacteria 15604
39 Ga0123353_10159262 3300010167 Bacteria 3595
40 IMNBL1DRAFT_c0000005 3300000062 Bacteria 248552
41 IMNBL1DRAFT_c0010355 3300000062 Bacteria 4479
42 JGI24703J35330_11748621 3300002501 Bacteria 22438
43 Ga0072941_1072940 3300005201 Bacteria 6177
44 Ga0466690_146851 3300042590 Bacteria 110739
45 Ga0466692_124797 3300042591 Bacteria 10415
46 Ga0466691_175106 3300042593 Bacteria 13132
47 Ga0466696_005173 3300042596 Bacteria 9888
48 Ga0466705_278952 3300042612 Bacteria 5430
49 Ga0466705_286184 3300042612 Bacteria 8385
50 Ga0466703_084988 3300042636 Bacteria 37482
51 Ga0466703_181012 3300042636 Bacteria 22339
52 Ga0466703_203122 3300042636 Bacteria 7939
53 Ga0466703_261229 3300042636 Bacteria 7155
54 Ga0466704_026298 3300042643 Bacteria 3743
55 Ga0466709_005444 3300042648 Bacteria 2280
56 Ga0466708_007204 3300042652 Bacteria 2241
57 Ga0466708_181435 3300042652 Bacteria 4618
58 Ga0466706_148803 3300042599 Bacteria 11975
59 Ga0466707_353377 3300042601 Bacteria 105005
60 Ga0466713_017270 3300042602 Bacteria 126285
61 Ga0466713_142256 3300042602 Unclassified 27489
62 Ga0466719_348214 3300042606 Bacteria 3356
63 Ga0466722_238539 3300042609 Bacteria 3290
64 Ga0466712_187668 3300042614 Bacteria 25579
65 Ga0466712_214134 3300042614 Bacteria 4469
66 Ga0466711_032949 3300042615 Bacteria 3152
67 Ga0466711_413936 3300042615 Bacteria 12913
68 Ga0466711_435117 3300042615 Bacteria 6205
69 Ga0466715_428033 3300042616 Bacteria 3624
70 Ga0466723_160913 3300042618 Bacteria 32817
71 Ga0466723_174351 3300042618 Bacteria 3457
72 Ga0466723_238119 3300042618 Bacteria 10350
73 Ga0466726_230209 3300042619 Bacteria 1888
74 Ga0466728_023717 3300042620 Bacteria 4269
75 Ga0123355_10013554 3300009826 Bacteria 12698
76 Ga0123356_10000490 3300010049 Bacteria 44075
77 Ga0123353_10047776 3300010167 Bacteria 6810
78 IMNBL1DRAFT_c0000021 3300000062 Bacteria 148886
79 Ga0072941_1001734 3300005201 Bacteria 34764
80 Ga0123357_10000067 3300009784 Bacteria 84688
81 Ga0160452_100068 3300012834 Bacteria 140253
82 Ga0456237_0000792 3300041968 Bacteria 4907
83 Ga0466690_061675 3300042590 Unclassified 2839
84 Ga0466690_243554 3300042590 Bacteria 43818
85 Ga0466691_094213 3300042593 Bacteria 7921
86 Ga0466696_294748 3300042596 Bacteria 2439
87 Ga0466696_336189 3300042596 Bacteria 13799
88 Ga0466705_058418 3300042612 Unclassified 7048
89 Ga0466705_194577 3300042612 Bacteria 2306
90 Ga0466704_051116 3300042643 Bacteria 38647
91 Ga0466704_079971 3300042643 Bacteria 7652
92 Ga0466709_135527 3300042648 Bacteria 31176
93 Ga0466709_307488 3300042648 Bacteria 38952
94 Ga0466707_064723 3300042601 Bacteria 2534
95 Ga0466707_247506 3300042601 Bacteria 4201
96 Ga0466714_031987 3300042603 Bacteria 4677
97 Ga0466716_009812 3300042605 Bacteria 7063
98 Ga0466719_013039 3300042606 Bacteria 13418
99 Ga0466719_238818 3300042606 Bacteria 2004
100 Ga0466719_513423 3300042606 Bacteria 10568
101 Ga0466722_047262 3300042609 Bacteria 44133
102 Ga0466722_082170 3300042609 Bacteria 7796
103 Ga0466711_136877 3300042615 Bacteria 36292
104 Ga0466711_401874 3300042615 Bacteria 14305
105 Ga0466715_087961 3300042616 Bacteria 17232
106 Ga0466715_262210 3300042616 Bacteria 35550
107 Ga0466723_220532 3300042618 Bacteria 7285
108 Ga0466726_316944 3300042619 Bacteria 2991
109 Ga0466728_156011 3300042620 Bacteria 2454
110 Ga0123353_10003115 3300010167 Bacteria 20798
111 2212191336 2209111004 Bacteria 10245
112 IMNBL1DRAFT_c0005883 3300000062 Bacteria 6871
113 IMNBL1DRAFT_c0008100 3300000062 Bacteria 5407
114 JGI24696J40584_12960224 3300002834 Bacteria 6657
115 Ga0072940_1065051 3300005200 Bacteria 2213
116 Ga0415639_048024 3300038395 Bacteria 8483
117 Ga0466692_204783 3300042591 Bacteria 4721
118 Ga0466691_009903 3300042593 Bacteria 4675
119 Ga0466691_162483 3300042593 Bacteria 4111
120 Ga0466696_026170 3300042596 Bacteria 2007
121 Ga0466705_236504 3300042612 Bacteria 2736
122 Ga0466703_247142 3300042636 Bacteria 96407
123 Ga0466703_308976 3300042636 Bacteria 12468
124 Ga0466704_077768 3300042643 Bacteria 26239
125 Ga0466704_500708 3300042643 Bacteria 15237
126 Ga0466709_074673 3300042648 Bacteria 10044
127 Ga0466706_038765 3300042599 Bacteria 36318
128 Ga0466713_112738 3300042602 Bacteria 100011
129 Ga0466713_129417 3300042602 Bacteria 66756
130 Ga0466717_154236 3300042604 Bacteria 4214
131 Ga0466716_210240 3300042605 Bacteria 36809
132 Ga0466719_009138 3300042606 Bacteria 3952
133 Ga0466719_159024 3300042606 Bacteria 18310
134 Ga0466719_368694 3300042606 Bacteria 3116
135 Ga0466722_230538 3300042609 Bacteria 16030
136 Ga0466715_217434 3300042616 Bacteria 17308
137 Ga0466715_326145 3300042616 Bacteria 37884
138 Ga0466718_087814 3300042617 Bacteria 3615
139 Ga0466723_009675 3300042618 Bacteria 2820
140 Ga0466723_063701 3300042618 Bacteria 28262
141 Ga0466723_205772 3300042618 Bacteria 8872
142 Ga0123353_10047781 3300010167 Bacteria 6810
143 Ga0123353_10147181 3300010167 Bacteria 3765
144 Ga0123354_10001235 3300010882 Bacteria 30314
145 Ga0123354_10039399 3300010882 Bacteria 7325
146 DPOL_contig13995 2035918003 Bacteria 69230
147 IMNBL1DRAFT_c0001151 3300000062 Bacteria 20195
148 IMNBL1DRAFT_c0014156 3300000062 Bacteria 3539
149 JGI24698J34947_10000782 3300002449 Bacteria 15804
150 JGI24702J35022_10009560 3300002462 Bacteria 5435
151 Ga0063521_1001253 3300003973 Unclassified 7328
152 Ga0466690_182750 3300042590 Bacteria 24839
153 Ga0466690_421764 3300042590 Bacteria 5067
154 Ga0466696_285136 3300042596 Bacteria 11592
155 Ga0466696_361474 3300042596 Bacteria 23704
156 Ga0466705_363037 3300042612 Bacteria 9036
157 Ga0466703_269166 3300042636 Bacteria 5155
158 Ga0466703_270123 3300042636 Unclassified 3994
159 Ga0466704_149197 3300042643 Bacteria 4785
160 Ga0466704_153702 3300042643 Bacteria 14778
161 Ga0466708_049312 3300042652 Bacteria 30228
162 Ga0466725_092761 3300042654 Bacteria 6554
163 Ga0466727_051911 3300042655 Bacteria 14691
164 Ga0466719_324638 3300042606 Bacteria 8947
165 Ga0466719_391887 3300042606 Bacteria 5353
166 Ga0466722_025485 3300042609 Bacteria 59385
167 Ga0466711_425720 3300042615 Bacteria 4754
168 Ga0466711_471385 3300042615 Bacteria 2440
169 Ga0466715_584313 3300042616 Bacteria 25336
170 Ga0466715_618225 3300042616 Bacteria 18057
171 Ga0466723_021437 3300042618 Bacteria 14514
172 Ga0466723_059959 3300042618 Bacteria 1976
173 Ga0466726_196658 3300042619 Bacteria 4903
174 Ga0466726_316888 3300042619 Bacteria 11804
175 Ga0466726_472750 3300042619 Bacteria 2490
176 Ga0123357_10021315 3300009784 Bacteria 8676
177 Ga0123356_10198904 3300010049 Bacteria 2042
178 Ga0123353_10169058 3300010167 Bacteria 3472
179 2227194707 2225789004 Bacteria 7841
180 2227566312 2225789004 Bacteria 14111
181 2227619063 2225789004 Bacteria 44654
182 JGI24698J34947_10000897 3300002449 Unclassified 15086
183 JGI24698J34947_10002027 3300002449 Bacteria 10801
184 Ga0466690_007442 3300042590 Unclassified 7395
185 Ga0466691_029705 3300042593 Bacteria 33995
186 Ga0466691_126270 3300042593 Bacteria 2047
187 Ga0466694_052783 3300042594 Bacteria 9647
188 Ga0466735_018679 3300042624 Bacteria 1715
189 Ga0466735_105285 3300042624 Bacteria 10897
190 Ga0466703_200348 3300042636 Bacteria 25667
191 Ga0466703_423403 3300042636 Bacteria 132694
192 Ga0466704_146260 3300042643 Bacteria 3032
193 Ga0466704_240234 3300042643 Bacteria 65177
194 Ga0466704_274968 3300042643 Bacteria 1681
195 Ga0466708_082101 3300042652 Bacteria 6650
196 Ga0466708_269645 3300042652 Bacteria 39521
197 Ga0466708_389147 3300042652 Bacteria 12512
198 Ga0466707_110720 3300042601 Bacteria 3207
199 Ga0466707_220554 3300042601 Bacteria 7006
200 Ga0466707_327546 3300042601 Bacteria 2019
201 Ga0466707_409948 3300042601 Unclassified 14484
202 Ga0466713_025223 3300042602 Bacteria 106972
203 Ga0466719_025873 3300042606 Bacteria 4139
204 Ga0466719_104467 3300042606 Bacteria 52022
205 Ga0562378_0723 3300056814 Bacteria 47258
206 Ga0466705_511634 3300042612 Bacteria 2045
207 Ga0466712_169729 3300042614 Bacteria 7955
208 Ga0466711_415843 3300042615 Bacteria 7247
209 Ga0466715_117998 3300042616 Bacteria 15687
210 Ga0466715_366753 3300042616 Bacteria 6292
211 Ga0466723_001218 3300042618 Bacteria 4977
212 Ga0466723_007768 3300042618 Bacteria 2657
213 Ga0466723_039166 3300042618 Bacteria 11955
214 Ga0466723_075173 3300042618 Bacteria 100663
215 Ga0466723_274630 3300042618 Bacteria 2526
216 Ga0466726_017894 3300042619 Bacteria 11731
217 Ga0466726_146211 3300042619 Bacteria 14691
218 Ga0466726_249259 3300042619 Bacteria 4653
219 Ga0466726_308063 3300042619 Bacteria 4786
220 Ga0466728_242957 3300042620 Bacteria 11208
221 Ga0466729_124679 3300042621 Bacteria 47965
222 Ga0123353_10000251 3300010167 Bacteria 67704
223 Ga0123353_10277368 3300010167 Bacteria 2577
224 2227067746 2225789003 Unclassified 3055
225 IMNBL1DRAFT_c0001449 3300000062 Bacteria 17740
226 IMNBL1DRAFT_c0008762 3300000062 Bacteria 5103
227 JGI24698J34947_10000153 3300002449 Bacteria 26364
228 Ga0072941_1025326 3300005201 Unclassified 10993
229 Ga0466690_343702 3300042590 Bacteria 2510
230 Ga0466691_119073 3300042593 Bacteria 8604
231 Ga0466691_150133 3300042593 Bacteria 24134
232 Ga0466691_197795 3300042593 Unclassified 5842
233 Ga0466696_171103 3300042596 Bacteria 5300
234 Ga0466696_228153 3300042596 Bacteria 3463
235 Ga0466701_005562 3300042598 Bacteria 41288
236 Ga0466705_175538 3300042612 Bacteria 4607
237 Ga0466705_301803 3300042612 Unclassified 3090
238 Ga0466735_203996 3300042624 Bacteria 3894
239 Ga0466703_353397 3300042636 Bacteria 3671
240 Ga0466704_153841 3300042643 Bacteria 7684
241 Ga0466704_315544 3300042643 Bacteria 6621
242 Ga0466704_330894 3300042643 Bacteria 161855
243 Ga0466704_576894 3300042643 Bacteria 14984
244 Ga0466709_292242 3300042648 Bacteria 5598
245 Ga0466708_032132 3300042652 Bacteria 55974
246 Ga0466708_462836 3300042652 Bacteria 12811
247 Ga0466727_053683 3300042655 Bacteria 5100
248 Ga0466727_296831 3300042655 Bacteria 11310
249 Ga0466706_009677 3300042599 Bacteria 7829
250 Ga0466706_258120 3300042599 Bacteria 3715
251 Ga0466707_147316 3300042601 Bacteria 5311
252 Ga0466707_226450 3300042601 Bacteria 25110
253 Ga0466713_154958 3300042602 Bacteria 2261
254 Ga0466719_109850 3300042606 Bacteria 3396
255 Ga0466719_309054 3300042606 Bacteria 10018
256 Ga0466719_576478 3300042606 Bacteria 13470
257 Ga0466705_443092 3300042612 Bacteria 12953
258 Ga0466712_315952 3300042614 Bacteria 13064
259 Ga0466711_391393 3300042615 Bacteria 5112
260 Ga0466715_099135 3300042616 Bacteria 29293
261 Ga0466715_247405 3300042616 Bacteria 4400
262 Ga0466715_291567 3300042616 Bacteria 2469
263 Ga0466723_032171 3300042618 Unclassified 6060
264 Ga0466723_064587 3300042618 Bacteria 2824
265 Ga0466723_290929 3300042618 Bacteria 5591
266 Ga0466726_124077 3300042619 Bacteria 25543
267 Ga0466728_104858 3300042620 Bacteria 2430
268 Ga0466728_359048 3300042620 Bacteria 6298
269 Ga0123355_10313050 3300009826 Bacteria 2125
270 2227364140 2225789004 Bacteria 6076
271 2227496845 2225789004 Bacteria 19985
272 JGI24698J34947_10004192 3300002449 Bacteria 7835
273 JGI24702J35022_10000780 3300002462 Bacteria 19744
274 Ga0063521_1000294 3300003973 Unclassified 30808
275 Ga0068302_10129852 3300005071 Bacteria 2349
276 Ga0072941_1055611 3300005201 Bacteria 114377
277 Ga0415639_021719 3300038395 Bacteria 4434
278 Ga0466690_067238 3300042590 Bacteria 3359
279 Ga0466690_108907 3300042590 Bacteria 2564
280 Ga0466692_011894 3300042591 Bacteria 12750
281 Ga0466691_048636 3300042593 Bacteria 17999
282 Ga0466691_090857 3300042593 Bacteria 7763
283 Ga0466691_118270 3300042593 Bacteria 14528
284 Ga0466691_132996 3300042593 Bacteria 31181
285 Ga0466696_016496 3300042596 Bacteria 5352
286 Ga0466696_019763 3300042596 Bacteria 9088
287 Ga0466735_178449 3300042624 Unclassified 1576
288 Ga0466703_116528 3300042636 Bacteria 5807
289 Ga0466703_312856 3300042636 Bacteria 8452
290 Ga0466704_041925 3300042643 Bacteria 3026
291 Ga0466704_125800 3300042643 Bacteria 10107
292 Ga0466704_190087 3300042643 Bacteria 15645
293 Ga0466704_247752 3300042643 Bacteria 43747
294 Ga0466704_255186 3300042643 Bacteria 4914
295 Ga0466709_328653 3300042648 Bacteria 8718
296 Ga0466708_116940 3300042652 Bacteria 11921
297 Ga0466708_238095 3300042652 Bacteria 3713
298 Ga0466727_167529 3300042655 Bacteria 13631
299 Ga0466713_029384 3300042602 Bacteria 7260
300 Ga0466719_005088 3300042606 Bacteria 5363
301 Ga0466719_091304 3300042606 Bacteria 3924
302 Ga0466719_535056 3300042606 Bacteria 5962
303 Ga0466722_168943 3300042609 Bacteria 8678

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00664 ABC_membrane ABC transporter transmembrane region 70 336 0.99
PF00005 ABC_tran ABC transporter 412 561 0.89
PF02463 SMC_N RecF/RecN/SMC N terminal domain 464 601 0.76

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.