Protein Family IF09488
Metagenome
Isolate
172
Members
136
Samples
93
Scaffolds
405.87
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_365633|Ga0466704_365633_1497_2792
- Length
- 431 aa
- Sequence
- LHYENLPFILAENISIITIFAGNFFMYKNELILISISGEDKPGVTAALTGILAHYNAAILDIGQADIHSMLSLGILFQTTDADSGKILKELLFKCYELGVSIKFTPVAETDYSHWVTLQGKNRYIITILTKKLNAKQLSAIASIVSEQGLNIDDINRLTGRIPLDESCRASKASIEFSVRGTPKDPKGIQKRFMELSSELDMDISFQEESMFRRTRRLICFDMDSTLIEAEVIDELAARNGVGEQVKAITESAMRGEMDFAESFTQRVSLLRGLDVSVMQEIAEKLPITEGTDRLMKVLKRIGFKIAILSGGFTYFGNYLKQKYAIDYVYANELEIENGKLTGRHLGDIVDGKRKAELLRLIAQVEKVDIRQTVAVGDGANDLPMISIAGLGIAFHAKPKVKANAKQSISTTGLDGILYFLGYKDSHIDEK
Sample Types
Isolate
45.9%
Metagenome
54.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
23.6%
Elmidae
11.0%
Unclassified
11.0%
Curculionidae
7.9%
Kalotermitidae
7.9%
Termitidae
7.9%
Culicidae
4.7%
Apidae
4.7%
Formicidae
4.7%
Rhinotermitidae
2.4%
Armadillidiidae
2.4%
Drosophilidae
2.4%
Hydrophilidae
1.6%
Passalidae
1.6%
Trigoniulidae
0.8%
Pediculidae
0.8%
Hodotermitidae
0.8%
Noctuidae
0.8%
Tenebrionidae
0.8%
Gryllidae
0.8%
Termopsidae
0.8%
Siricidae
0.8%
Taxonomy
Archaea
0
Bacteria
154
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 2 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 3 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 4 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 5 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 6 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 7 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 8 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 14 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 18 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 19 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 20 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 21 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 22 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 23 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 24 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 27 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 31 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 32 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 33 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 34 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 35 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 36 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 37 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 38 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 39 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 40 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 41 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 42 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 43 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 44 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 50 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 51 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 52 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 53 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 54 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 55 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 56 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 57 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 58 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 59 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 60 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 61 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 62 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 63 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 64 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 65 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 66 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 67 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 68 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 69 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 70 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 71 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 72 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 73 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 74 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 75 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 76 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 77 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 78 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 79 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 80 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 81 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 82 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 83 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 84 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 85 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 86 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 87 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 88 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 89 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 90 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 91 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 92 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 93 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 94 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 95 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 96 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 97 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 98 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 99 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 100 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 101 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 102 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 103 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 104 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 105 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 106 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 107 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 108 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 109 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 110 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 111 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 112 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 113 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 114 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 115 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 116 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 117 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 118 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 119 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 120 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 121 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 122 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 123 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 124 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 125 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 126 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 127 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 128 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 129 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 130 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 131 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 132 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 133 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 134 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 135 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 136 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_147786 | 3300042659 | Bacteria | 17146 |
| 2 | Ga0466713_023716 | 3300042602 | Bacteria | 83788 |
| 3 | Ga0466713_085684 | 3300042602 | Bacteria | 10734 |
| 4 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 5 | Ga0466714_088435 | 3300042603 | Bacteria | 2297 |
| 6 | FGTW_contig31339 | 2065487013 | Bacteria | 4498 |
| 7 | 2227055368 | 2225789003 | Bacteria | 3806 |
| 8 | HBC_ctgsDRAFT_1000103 | 3300000333 | Bacteria | 21558 |
| 9 | Ga0104049_1132258 | 3300007103 | Bacteria | 1820 |
| 10 | Ga0104050_1003004 | 3300007153 | Bacteria | 5040 |
| 11 | Ga0160453_101150 | 3300012814 | Unclassified | 10869 |
| 12 | Ga0160440_101947 | 3300012815 | Unclassified | 2338 |
| 13 | Ga0160436_1004152 | 3300012861 | Unclassified | 3479 |
| 14 | Ga0466715_335442 | 3300042616 | Unclassified | 8314 |
| 15 | Ga0466730_085631 | 3300042625 | Bacteria | 48091 |
| 16 | Ga0123356_10000003 | 3300010049 | Bacteria | 290856 |
| 17 | Ga0466713_037753 | 3300042602 | Bacteria | 20566 |
| 18 | SPBB_contig00276 | 2044078006 | Bacteria | 18066 |
| 19 | Ga0068305_10005588 | 3300005083 | Bacteria | 137553 |
| 20 | Ga0102734_1002906 | 3300007129 | Bacteria | 6463 |
| 21 | Ga0104019_1002401 | 3300007150 | Bacteria | 15400 |
| 22 | Ga0466696_104026 | 3300042596 | Bacteria | 7592 |
| 23 | Ga0466696_278891 | 3300042596 | Bacteria | 171866 |
| 24 | Ga0466711_235523 | 3300042615 | Bacteria | 11905 |
| 25 | Ga0466715_024930 | 3300042616 | Bacteria | 21877 |
| 26 | Ga0466709_321469 | 3300042648 | Bacteria | 19890 |
| 27 | Ga0160466_100240 | 3300012809 | Unclassified | 37523 |
| 28 | Ga0466705_209863 | 3300042612 | Bacteria | 31460 |
| 29 | Ga0466732_161312 | 3300042656 | Bacteria | 40269 |
| 30 | IMNBL1DRAFT_c0016445 | 3300000062 | Bacteria | 3166 |
| 31 | Ga0102735_1000724 | 3300007080 | Bacteria | 7813 |
| 32 | Ga0160430_106653 | 3300012852 | Unclassified | 2435 |
| 33 | Ga0466711_333068 | 3300042615 | Bacteria | 45034 |
| 34 | Ga0466724_24016 | 3300042649 | Bacteria | 23228 |
| 35 | Ga0466701_076263 | 3300042598 | Bacteria | 44102 |
| 36 | Ga0466713_118549 | 3300042602 | Bacteria | 2208 |
| 37 | Ga0466713_134989 | 3300042602 | Bacteria | 147812 |
| 38 | SPBB_contig11450 | 2044078006 | Bacteria | 33174 |
| 39 | SWWA_contig21627__length_35650___numreads_2069 | 2100351016 | Bacteria | 35650 |
| 40 | Ga0466726_394502 | 3300042619 | Bacteria | 20779 |
| 41 | Ga0466703_386861 | 3300042636 | Bacteria | 2449 |
| 42 | Ga0466704_002459 | 3300042643 | Bacteria | 2045 |
| 43 | Ga0466704_365633 | 3300042643 | Bacteria | 19528 |
| 44 | Ga0123354_10095496 | 3300010882 | Bacteria | 4068 |
| 45 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 46 | Ga0103264_1000001 | 3300007188 | Bacteria | 204769 |
| 47 | Ga0103267_1000527 | 3300007190 | Bacteria | 11474 |
| 48 | Ga0160460_100597 | 3300012845 | Unclassified | 18870 |
| 49 | Ga0316159_11804 | 3300030930 | Bacteria | 2544 |
| 50 | Ga0466699_013366 | 3300042597 | Bacteria | 1486 |
| 51 | Ga0466711_197629 | 3300042615 | Bacteria | 15651 |
| 52 | Ga0466730_016417 | 3300042625 | Unclassified | 9853 |
| 53 | Ga0466730_017818 | 3300042625 | Unclassified | 5406 |
| 54 | Ga0466706_019839 | 3300042599 | Bacteria | 3305 |
| 55 | DPO_contig00380 | 2032320009 | Unclassified | 18287 |
| 56 | DPO_contig07409 | 2032320009 | Unclassified | 17559 |
| 57 | IMNBL1DRAFT_c0001838 | 3300000062 | Bacteria | 15467 |
| 58 | HBC_ctgsDRAFT_1000057 | 3300000333 | Bacteria | 28438 |
| 59 | Meta3P_1008084 | 3300002464 | Bacteria | 7864 |
| 60 | Ga0103268_1001202 | 3300007192 | Bacteria | 6659 |
| 61 | Ga0160433_100164 | 3300012846 | Bacteria | 55660 |
| 62 | Ga0466711_010847 | 3300042615 | Bacteria | 41256 |
| 63 | Ga0466724_43341 | 3300042649 | Unclassified | 22861 |
| 64 | Ga0466724_45279 | 3300042649 | Bacteria | 107209 |
| 65 | Ga0466708_193083 | 3300042652 | Bacteria | 20729 |
| 66 | Ga0123355_10009814 | 3300009826 | Unclassified | 14609 |
| 67 | Ga0123356_10009414 | 3300010049 | Bacteria | 9646 |
| 68 | Ga0123354_10058311 | 3300010882 | Bacteria | 5738 |
| 69 | Ga0160465_100843 | 3300012803 | Unclassified | 11068 |
| 70 | Ga0466705_373867 | 3300042612 | Unclassified | 5735 |
| 71 | Ga0466733_003667 | 3300042659 | Bacteria | 192892 |
| 72 | DPOL_contig18015 | 2035918003 | Bacteria | 29524 |
| 73 | Ga0072941_1017238 | 3300005201 | Bacteria | 4341 |
| 74 | Ga0466692_159991 | 3300042591 | Bacteria | 5952 |
| 75 | Ga0466711_309359 | 3300042615 | Bacteria | 4717 |
| 76 | Ga0466715_110643 | 3300042616 | Bacteria | 33895 |
| 77 | Ga0466703_079887 | 3300042636 | Bacteria | 3308 |
| 78 | Ga0466708_330262 | 3300042652 | Bacteria | 27220 |
| 79 | Ga0466733_184838 | 3300042659 | Bacteria | 40918 |
| 80 | Ga0466701_057980 | 3300042598 | Bacteria | 195772 |
| 81 | Ga0466701_089861 | 3300042598 | Bacteria | 71855 |
| 82 | Ga0466707_202008 | 3300042601 | Bacteria | 2299 |
| 83 | Ga0160469_100744 | 3300012824 | Bacteria | 11950 |
| 84 | Ga0160446_100238 | 3300012835 | Bacteria | 35142 |
| 85 | Ga0160443_100601 | 3300012848 | Unclassified | 21052 |
| 86 | Ga0466690_036477 | 3300042590 | Bacteria | 37654 |
| 87 | Ga0466696_434252 | 3300042596 | Bacteria | 17761 |
| 88 | Ga0466728_191331 | 3300042620 | Bacteria | 29159 |
| 89 | Ga0466730_022614 | 3300042625 | Unclassified | 3632 |
| 90 | Ga0466730_057968 | 3300042625 | Bacteria | 28148 |
| 91 | Ga0466703_325457 | 3300042636 | Unclassified | 5753 |
| 92 | Ga0466724_16069 | 3300042649 | Bacteria | 22889 |
| 93 | Ga0123354_10000807 | 3300010882 | Bacteria | 34342 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13740 | ACT_6 | ACT domain | 30 | 104 | 0.98 |
| PF08282 | Hydrolase_3 | haloacid dehalogenase-like hydrolase | 352 | 421 | 0.92 |
| PF00702 | Hydrolase | haloacid dehalogenase-like hydrolase | 217 | 390 | 0.9 |
| PF12710 | HAD | haloacid dehalogenase-like hydrolase | 220 | 386 | 0.89 |
| PF21086 | ACT_PSP_2 | ACT domain | 125 | 206 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.