Protein Family IF09456
Metagenome
Isolate
214
Members
70
Samples
203
Scaffolds
144.99
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_293633|Ga0466704_293633_3459_3947
- Length
- 162 aa
- Sequence
- LQINSFAQKQQNSLNINDLSSNLRSGRQRQFDCRYLEMARIWGKNSYCKRRQVGALLVKDRVIISDGYNGTPSGFENECEEDGVTKPYVLHAEANAITKVAKSNNSSEGATLYVTSSPCVECAKLIIQAGVKRVVFADHYHDVNGIGLLERAGIEVEQINID
Sample Types
Isolate
5.1%
Metagenome
94.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.2%
Kalotermitidae
20.6%
Unclassified
11.8%
Blattidae
5.9%
Rhinotermitidae
5.9%
Formicidae
5.9%
Termopsidae
4.4%
Passalidae
2.9%
Hodotermitidae
1.5%
Elmidae
1.5%
Tenebrionidae
1.5%
Taxonomy
Archaea
0
Bacteria
205
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 2 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 5 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 9 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 13 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 17 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 30 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 41 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 42 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 43 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 49 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 50 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 51 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 52 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 53 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 54 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 55 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 56 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 57 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 58 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 59 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 60 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 61 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 62 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 63 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 64 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 65 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 66 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 67 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 68 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 69 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 70 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_232153 | 3300042612 | Unclassified | 17897 |
| 2 | Ga0466733_140351 | 3300042659 | Bacteria | 7410 |
| 3 | Ga0466733_170029 | 3300042659 | Bacteria | 24463 |
| 4 | Ga0466706_001642 | 3300042599 | Bacteria | 38891 |
| 5 | Ga0466706_012545 | 3300042599 | Bacteria | 1117 |
| 6 | Ga0466700_036073 | 3300042600 | Bacteria | 2096 |
| 7 | Ga0466707_012433 | 3300042601 | Bacteria | 1816 |
| 8 | Ga0466707_111686 | 3300042601 | Bacteria | 2867 |
| 9 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 10 | Ga0466714_137522 | 3300042603 | Bacteria | 1861 |
| 11 | Ga0466722_215606 | 3300042609 | Bacteria | 1655 |
| 12 | Ga0466722_240768 | 3300042609 | Bacteria | 19386 |
| 13 | IMNBL1DRAFT_c0021349 | 3300000062 | Bacteria | 2593 |
| 14 | JGI24702J35022_10009089 | 3300002462 | Bacteria | 5596 |
| 15 | JGI24702J35022_10205364 | 3300002462 | Bacteria | 1129 |
| 16 | Ga0072940_1122540 | 3300005200 | Bacteria | 2301 |
| 17 | Ga0466696_306565 | 3300042596 | Bacteria | 2548 |
| 18 | Ga0466696_454466 | 3300042596 | Bacteria | 2140 |
| 19 | Ga0466731_157844 | 3300042622 | Bacteria | 1720 |
| 20 | Ga0466735_168988 | 3300042624 | Bacteria | 1281 |
| 21 | Ga0466703_082546 | 3300042636 | Bacteria | 11791 |
| 22 | Ga0466704_077855 | 3300042643 | Bacteria | 18698 |
| 23 | Ga0466704_293633 | 3300042643 | Bacteria | 4330 |
| 24 | Ga0466709_012440 | 3300042648 | Bacteria | 7482 |
| 25 | Ga0466709_156488 | 3300042648 | Bacteria | 77037 |
| 26 | Ga0466724_46543 | 3300042649 | Bacteria | 311178 |
| 27 | Ga0466697_247837 | 3300042611 | Bacteria | 1163 |
| 28 | Ga0466705_335705 | 3300042612 | Bacteria | 4572 |
| 29 | Ga0466705_376125 | 3300042612 | Bacteria | 32089 |
| 30 | Ga0466705_384051 | 3300042612 | Bacteria | 8346 |
| 31 | Ga0466732_086064 | 3300042656 | Bacteria | 15640 |
| 32 | Ga0466733_088826 | 3300042659 | Bacteria | 19910 |
| 33 | Ga0466711_154251 | 3300042615 | Bacteria | 6424 |
| 34 | Ga0466715_007714 | 3300042616 | Bacteria | 20281 |
| 35 | Ga0466715_037900 | 3300042616 | Bacteria | 143938 |
| 36 | Ga0466715_613585 | 3300042616 | Bacteria | 24795 |
| 37 | Ga0466723_053207 | 3300042618 | Bacteria | 23381 |
| 38 | Ga0466726_187244 | 3300042619 | Bacteria | 6679 |
| 39 | Ga0466707_287159 | 3300042601 | Bacteria | 1061 |
| 40 | Ga0466713_103922 | 3300042602 | Bacteria | 25414 |
| 41 | Ga0466719_133938 | 3300042606 | Bacteria | 1675 |
| 42 | Ga0466722_136407 | 3300042609 | Bacteria | 11020 |
| 43 | Ga0466722_146807 | 3300042609 | Bacteria | 6613 |
| 44 | Ga0123356_10447442 | 3300010049 | Bacteria | 1439 |
| 45 | Ga0123353_10754201 | 3300010167 | Bacteria | 1354 |
| 46 | Ga0123353_11471528 | 3300010167 | Bacteria | 870 |
| 47 | Ga0072941_1113299 | 3300005201 | Bacteria | 2751 |
| 48 | Ga0102735_1000448 | 3300007080 | Bacteria | 15147 |
| 49 | Ga0102734_1000277 | 3300007129 | Unclassified | 15762 |
| 50 | Ga0265387_1001491 | 3300024582 | Bacteria | 3433 |
| 51 | Ga0466693_252782 | 3300042592 | Bacteria | 3565 |
| 52 | Ga0466691_021365 | 3300042593 | Bacteria | 17759 |
| 53 | Ga0466691_162389 | 3300042593 | Unclassified | 1425 |
| 54 | Ga0466735_182589 | 3300042624 | Bacteria | 2603 |
| 55 | Ga0466704_558196 | 3300042643 | Bacteria | 4661 |
| 56 | Ga0466709_143793 | 3300042648 | Bacteria | 9535 |
| 57 | Ga0466709_198981 | 3300042648 | Unclassified | 1128 |
| 58 | Ga0466733_215888 | 3300042659 | Bacteria | 1330 |
| 59 | Ga0466711_046639 | 3300042615 | Bacteria | 1589 |
| 60 | Ga0466711_109380 | 3300042615 | Bacteria | 31839 |
| 61 | Ga0466718_055065 | 3300042617 | Bacteria | 2168 |
| 62 | Ga0466706_017961 | 3300042599 | Bacteria | 2793 |
| 63 | Ga0466700_377078 | 3300042600 | Bacteria | 1520 |
| 64 | Ga0466707_016104 | 3300042601 | Bacteria | 15234 |
| 65 | Ga0466707_050196 | 3300042601 | Bacteria | 4702 |
| 66 | Ga0466713_012307 | 3300042602 | Bacteria | 58290 |
| 67 | Ga0466713_018694 | 3300042602 | Bacteria | 10231 |
| 68 | Ga0466716_020109 | 3300042605 | Bacteria | 1187 |
| 69 | Ga0466719_112981 | 3300042606 | Bacteria | 1726 |
| 70 | Ga0123357_10078962 | 3300009784 | Bacteria | 4335 |
| 71 | Ga0123353_10432656 | 3300010167 | Bacteria | 1945 |
| 72 | IMNBL1DRAFT_c0019891 | 3300000062 | Bacteria | 2735 |
| 73 | JGI24702J35022_10000746 | 3300002462 | Bacteria | 20053 |
| 74 | Ga0415639_200761 | 3300038395 | Bacteria | 2076 |
| 75 | Ga0466656_197778 | 3300042550 | Bacteria | 1360 |
| 76 | Ga0466692_147996 | 3300042591 | Bacteria | 7875 |
| 77 | Ga0466694_219633 | 3300042594 | Bacteria | 1113 |
| 78 | Ga0466696_176263 | 3300042596 | Bacteria | 1586 |
| 79 | Ga0466696_219440 | 3300042596 | Bacteria | 17310 |
| 80 | Ga0466696_278891 | 3300042596 | Bacteria | 171866 |
| 81 | Ga0466735_017780 | 3300042624 | Bacteria | 2473 |
| 82 | Ga0466703_019316 | 3300042636 | Bacteria | 19998 |
| 83 | Ga0466705_506100 | 3300042612 | Bacteria | 25887 |
| 84 | Ga0466711_018539 | 3300042615 | Bacteria | 5856 |
| 85 | Ga0466711_123903 | 3300042615 | Bacteria | 10875 |
| 86 | Ga0466715_015265 | 3300042616 | Bacteria | 3511 |
| 87 | Ga0466715_471395 | 3300042616 | Bacteria | 5564 |
| 88 | Ga0466728_078813 | 3300042620 | Bacteria | 17956 |
| 89 | Ga0466713_060305 | 3300042602 | Bacteria | 8341 |
| 90 | Ga0466719_111248 | 3300042606 | Bacteria | 3179 |
| 91 | Ga0466722_244504 | 3300042609 | Bacteria | 11832 |
| 92 | Ga0123355_10000772 | 3300009826 | Bacteria | 43687 |
| 93 | Ga0123356_10090082 | 3300010049 | Unclassified | 2920 |
| 94 | Ga0123353_10116236 | 3300010167 | Bacteria | 4305 |
| 95 | Ga0123354_10000799 | 3300010882 | Bacteria | 34399 |
| 96 | 2227542421 | 2225789004 | Bacteria | 2971 |
| 97 | Ga0068305_10009014 | 3300005083 | Bacteria | 53295 |
| 98 | Ga0072941_1745038 | 3300005201 | Bacteria | 945 |
| 99 | Ga0466691_022426 | 3300042593 | Bacteria | 71333 |
| 100 | Ga0466696_012130 | 3300042596 | Bacteria | 5591 |
| 101 | Ga0466735_010719 | 3300042624 | Bacteria | 22017 |
| 102 | Ga0466703_254148 | 3300042636 | Bacteria | 23220 |
| 103 | Ga0466704_199203 | 3300042643 | Bacteria | 10322 |
| 104 | Ga0466725_014257 | 3300042654 | Bacteria | 50961 |
| 105 | Ga0466711_117551 | 3300042615 | Bacteria | 11311 |
| 106 | Ga0466711_446219 | 3300042615 | Bacteria | 7500 |
| 107 | Ga0466726_147634 | 3300042619 | Bacteria | 1078 |
| 108 | Ga0466728_027538 | 3300042620 | Bacteria | 7294 |
| 109 | Ga0466729_123526 | 3300042621 | Bacteria | 33019 |
| 110 | Ga0466706_039310 | 3300042599 | Bacteria | 25656 |
| 111 | Ga0466713_009775 | 3300042602 | Bacteria | 66246 |
| 112 | Ga0466719_086113 | 3300042606 | Bacteria | 2749 |
| 113 | Ga0466719_445360 | 3300042606 | Bacteria | 1835 |
| 114 | Ga0123353_10005186 | 3300010167 | Bacteria | 17027 |
| 115 | Ga0123353_10009487 | 3300010167 | Bacteria | 13445 |
| 116 | JGI24702J35022_10218040 | 3300002462 | Bacteria | 1098 |
| 117 | JGI24705J35276_12206528 | 3300002504 | Bacteria | 1723 |
| 118 | Ga0466692_077218 | 3300042591 | Bacteria | 1887 |
| 119 | Ga0466692_091832 | 3300042591 | Bacteria | 55079 |
| 120 | Ga0466691_025023 | 3300042593 | Bacteria | 10683 |
| 121 | Ga0466730_103185 | 3300042625 | Bacteria | 215676 |
| 122 | Ga0466703_241786 | 3300042636 | Bacteria | 1950 |
| 123 | Ga0466703_307651 | 3300042636 | Bacteria | 9241 |
| 124 | Ga0466704_082193 | 3300042643 | Bacteria | 8478 |
| 125 | Ga0466704_098066 | 3300042643 | Bacteria | 18725 |
| 126 | Ga0466704_287710 | 3300042643 | Bacteria | 14291 |
| 127 | Ga0466704_558352 | 3300042643 | Unclassified | 1531 |
| 128 | Ga0466725_443278 | 3300042654 | Bacteria | 1288 |
| 129 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 130 | Ga0466710_159728 | 3300042613 | Bacteria | 13105 |
| 131 | Ga0466715_159345 | 3300042616 | Bacteria | 29954 |
| 132 | Ga0466723_103648 | 3300042618 | Bacteria | 17894 |
| 133 | Ga0466723_334830 | 3300042618 | Bacteria | 13949 |
| 134 | Ga0466707_222304 | 3300042601 | Bacteria | 1240 |
| 135 | Ga0466707_290896 | 3300042601 | Bacteria | 2843 |
| 136 | Ga0466714_098947 | 3300042603 | Bacteria | 25874 |
| 137 | Ga0466722_051355 | 3300042609 | Bacteria | 31148 |
| 138 | 2227489633 | 2225789004 | Bacteria | 798 |
| 139 | IMNBL1DRAFT_c0003515 | 3300000062 | Bacteria | 10019 |
| 140 | JGI24702J35022_10016701 | 3300002462 | Bacteria | 4020 |
| 141 | JGI24702J35022_10147576 | 3300002462 | Bacteria | 1317 |
| 142 | Ga0466690_086237 | 3300042590 | Bacteria | 7872 |
| 143 | Ga0466696_358309 | 3300042596 | Bacteria | 3090 |
| 144 | Ga0466704_207509 | 3300042643 | Bacteria | 13537 |
| 145 | Ga0466704_575698 | 3300042643 | Unclassified | 11655 |
| 146 | Ga0466709_033872 | 3300042648 | Bacteria | 15123 |
| 147 | Ga0466709_191028 | 3300042648 | Bacteria | 2026 |
| 148 | Ga0466708_074679 | 3300042652 | Bacteria | 22411 |
| 149 | Ga0466705_221760 | 3300042612 | Bacteria | 3495 |
| 150 | Ga0466715_254628 | 3300042616 | Bacteria | 21177 |
| 151 | Ga0466728_282213 | 3300042620 | Bacteria | 9551 |
| 152 | Ga0466701_032786 | 3300042598 | Bacteria | 1019 |
| 153 | Ga0466701_083821 | 3300042598 | Bacteria | 1337 |
| 154 | Ga0466717_013203 | 3300042604 | Bacteria | 1569 |
| 155 | Ga0466716_026310 | 3300042605 | Bacteria | 16932 |
| 156 | Ga0466716_076910 | 3300042605 | Bacteria | 11677 |
| 157 | Ga0466722_116286 | 3300042609 | Bacteria | 3649 |
| 158 | Ga0466722_261518 | 3300042609 | Bacteria | 1286 |
| 159 | IMNBL1DRAFT_c0003327 | 3300000062 | Bacteria | 10435 |
| 160 | IMNBL1DRAFT_c0055750 | 3300000062 | Bacteria | 1216 |
| 161 | JGI24702J35022_10435374 | 3300002462 | Bacteria | 797 |
| 162 | JGI24705J35276_12237451 | 3300002504 | Bacteria | 11168 |
| 163 | Ga0103265_1007724 | 3300007068 | Bacteria | 2534 |
| 164 | Ga0103267_1010480 | 3300007190 | Unclassified | 7421 |
| 165 | Ga0466656_296751 | 3300042550 | Bacteria | 1013 |
| 166 | Ga0466691_065526 | 3300042593 | Bacteria | 12371 |
| 167 | Ga0466696_150205 | 3300042596 | Bacteria | 10583 |
| 168 | Ga0466696_304520 | 3300042596 | Bacteria | 7469 |
| 169 | Ga0466696_372228 | 3300042596 | Bacteria | 1267 |
| 170 | Ga0466735_038152 | 3300042624 | Bacteria | 2084 |
| 171 | Ga0466735_204671 | 3300042624 | Unclassified | 3682 |
| 172 | Ga0466735_223403 | 3300042624 | Bacteria | 2889 |
| 173 | Ga0466703_253942 | 3300042636 | Bacteria | 6239 |
| 174 | Ga0466704_126212 | 3300042643 | Bacteria | 12717 |
| 175 | Ga0466704_290303 | 3300042643 | Bacteria | 4822 |
| 176 | Ga0466709_168803 | 3300042648 | Bacteria | 2116 |
| 177 | Ga0466708_040680 | 3300042652 | Bacteria | 29797 |
| 178 | Ga0466725_275364 | 3300042654 | Bacteria | 1725 |
| 179 | Ga0466727_228551 | 3300042655 | Bacteria | 2893 |
| 180 | Ga0466715_281564 | 3300042616 | Bacteria | 45897 |
| 181 | Ga0466728_079520 | 3300042620 | Bacteria | 32961 |
| 182 | Ga0466706_054670 | 3300042599 | Bacteria | 52813 |
| 183 | Ga0466719_151669 | 3300042606 | Bacteria | 4151 |
| 184 | Ga0466719_323961 | 3300042606 | Bacteria | 7308 |
| 185 | Ga0466721_075675 | 3300042608 | Bacteria | 20229 |
| 186 | Ga0466722_005794 | 3300042609 | Bacteria | 2981 |
| 187 | Ga0466722_059494 | 3300042609 | Bacteria | 7148 |
| 188 | Ga0123356_10532773 | 3300010049 | Bacteria | 1334 |
| 189 | IMNBL1DRAFT_c0016964 | 3300000062 | Bacteria | 3089 |
| 190 | JGI24702J35022_10022691 | 3300002462 | Bacteria | 3394 |
| 191 | Ga0466690_325412 | 3300042590 | Bacteria | 27630 |
| 192 | Ga0466693_371460 | 3300042592 | Bacteria | 1988 |
| 193 | Ga0466691_077664 | 3300042593 | Bacteria | 11257 |
| 194 | Ga0466691_181397 | 3300042593 | Bacteria | 8411 |
| 195 | Ga0466696_159350 | 3300042596 | Bacteria | 1828 |
| 196 | Ga0466735_063754 | 3300042624 | Bacteria | 2319 |
| 197 | Ga0466735_078782 | 3300042624 | Bacteria | 1166 |
| 198 | Ga0466735_198945 | 3300042624 | Bacteria | 1051 |
| 199 | Ga0466704_374004 | 3300042643 | Bacteria | 15901 |
| 200 | Ga0466708_237408 | 3300042652 | Bacteria | 44666 |
| 201 | Ga0466708_360582 | 3300042652 | Bacteria | 19909 |
| 202 | Ga0466727_075634 | 3300042655 | Bacteria | 9423 |
| 203 | Ga0466727_225961 | 3300042655 | Bacteria | 24553 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00383 | dCMP_cyt_deam_1 | Cytidine and deoxycytidylate deaminase zinc-binding region | 32 | 137 | 0.93 |
| PF14437 | MafB19-deam | MafB19-like deaminase | 43 | 143 | 0.89 |
| PF14439 | Bd3614-deam | Bd3614-like deaminase | 87 | 136 | 0.84 |
| PF18750 | SNAD4 | Secreted Novel AID/APOBEC-like Deaminase 4 | 88 | 128 | 0.83 |
| PF08210 | APOBEC_N | APOBEC-like N-terminal domain | 89 | 128 | 0.83 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.