Protein Family IF09292
Metagenome
Isolate
204
Members
65
Samples
181
Scaffolds
314.89
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_387371|Ga0466703_387371_370_1545
- Length
- 391 aa
- Sequence
- MYANGARAVTFCAIRLRLATGESAAKMPASHDSLAADLNTSRVFNETAGTVWREISLKLRKNTLHLRHIINFIIINTMSAQTPFLVFSGGHSRYLAEKICNSLACPLGQMNTQHYADGEFSVSYEESIRGRDVFLVQSTFPNADNLMELLLMIDAAKRASAHSIIAVIPYFGWARQDRKDKPRVSIAAKLIADMLSTAGIDRLITMDLHADQIQGFFNVPVDHLYASSVFLEYIKRELPLDNLVIATPDVGGTKRASSYSKYLRIPMVICHKSRLRANEVAEMRIIGDVEGQDVLLVDDIVDTAGTITKAADLMMSNGAKSVRAITSHAVMSDPASMRVDQSSLTEIIFTDSIPYSKKCNKVKILSIADMFAEAIRRVCNDESISSLYVIK
Sample Types
Isolate
11.3%
Metagenome
88.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.9%
Termitidae
21.0%
Kalotermitidae
21.0%
Unclassified
8.1%
Termopsidae
6.5%
Rhinotermitidae
4.8%
Passalidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
186
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 8 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
| 9 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 10 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 11 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 12 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 13 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 14 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 15 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 16 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 17 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 18 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 31 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 32 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 33 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 43 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 44 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 45 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 49 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 50 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 51 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 52 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 53 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 54 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 55 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 56 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 57 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 58 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 59 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 60 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_196941 | 3300042599 | Bacteria | 3630 |
| 2 | Ga0466722_167338 | 3300042609 | Bacteria | 21617 |
| 3 | Ga0466698_309349 | 3300042610 | Bacteria | 4153 |
| 4 | Ga0466692_202144 | 3300042591 | Bacteria | 41419 |
| 5 | IMNBL1DRAFT_c0002812 | 3300000062 | Bacteria | 11750 |
| 6 | IMNBL1DRAFT_c0003538 | 3300000062 | Bacteria | 9952 |
| 7 | JGI24702J35022_10039228 | 3300002462 | Bacteria | 2527 |
| 8 | Ga0068302_10015968 | 3300005071 | Bacteria | 8084 |
| 9 | Ga0068305_10018050 | 3300005083 | Bacteria | 28356 |
| 10 | Ga0466705_024668 | 3300042612 | Bacteria | 5372 |
| 11 | Ga0466705_240727 | 3300042612 | Unclassified | 1237 |
| 12 | Ga0466735_129219 | 3300042624 | Bacteria | 2616 |
| 13 | Ga0466735_236218 | 3300042624 | Unclassified | 2585 |
| 14 | Ga0466703_182449 | 3300042636 | Bacteria | 10635 |
| 15 | Ga0466703_223598 | 3300042636 | Bacteria | 8227 |
| 16 | Ga0466704_085401 | 3300042643 | Unclassified | 21536 |
| 17 | Ga0466704_442284 | 3300042643 | Unclassified | 7976 |
| 18 | Ga0466704_527214 | 3300042643 | Unclassified | 4269 |
| 19 | Ga0466708_067348 | 3300042652 | Bacteria | 6384 |
| 20 | Ga0466727_140090 | 3300042655 | Bacteria | 2509 |
| 21 | Ga0123353_10544193 | 3300010167 | Bacteria | 1677 |
| 22 | Ga0123354_10389782 | 3300010882 | Bacteria | 1192 |
| 23 | Ga0466705_426325 | 3300042612 | Bacteria | 4324 |
| 24 | Ga0466705_527929 | 3300042612 | Bacteria | 1520 |
| 25 | Ga0466715_072088 | 3300042616 | Bacteria | 72248 |
| 26 | Ga0466715_160020 | 3300042616 | Bacteria | 7262 |
| 27 | Ga0466729_108976 | 3300042621 | Bacteria | 26843 |
| 28 | Ga0466706_194286 | 3300042599 | Bacteria | 4869 |
| 29 | Ga0466700_175514 | 3300042600 | Bacteria | 1125 |
| 30 | Ga0466707_037091 | 3300042601 | Bacteria | 7897 |
| 31 | Ga0466707_178061 | 3300042601 | Bacteria | 2743 |
| 32 | Ga0466707_361948 | 3300042601 | Bacteria | 5267 |
| 33 | Ga0466719_030704 | 3300042606 | Bacteria | 2517 |
| 34 | Ga0466722_229738 | 3300042609 | Bacteria | 42096 |
| 35 | Ga0466722_232470 | 3300042609 | Bacteria | 73289 |
| 36 | Ga0466656_039996 | 3300042550 | Bacteria | 11141 |
| 37 | Ga0466692_137704 | 3300042591 | Bacteria | 14206 |
| 38 | Ga0466696_041872 | 3300042596 | Bacteria | 15709 |
| 39 | 2227180804 | 2225789004 | Unclassified | 8059 |
| 40 | JGI24702J35022_10000916 | 3300002462 | Bacteria | 18359 |
| 41 | JGI24702J35022_10008122 | 3300002462 | Bacteria | 5970 |
| 42 | JGI24702J35022_10011670 | 3300002462 | Bacteria | 4898 |
| 43 | JGI24702J35022_10018531 | 3300002462 | Bacteria | 3794 |
| 44 | Ga0466735_022134 | 3300042624 | Unclassified | 4386 |
| 45 | Ga0466709_044971 | 3300042648 | Bacteria | 10751 |
| 46 | Ga0466727_077521 | 3300042655 | Bacteria | 2361 |
| 47 | Ga0123353_10269583 | 3300010167 | Bacteria | 2624 |
| 48 | Ga0466711_286632 | 3300042615 | Bacteria | 2707 |
| 49 | Ga0466726_150117 | 3300042619 | Bacteria | 3263 |
| 50 | Ga0466733_167583 | 3300042659 | Bacteria | 1787 |
| 51 | Ga0466733_203605 | 3300042659 | Bacteria | 93930 |
| 52 | Ga0466713_035970 | 3300042602 | Bacteria | 22596 |
| 53 | Ga0466716_117310 | 3300042605 | Unclassified | 5318 |
| 54 | Ga0466719_350953 | 3300042606 | Bacteria | 2597 |
| 55 | Ga0466719_442711 | 3300042606 | Bacteria | 4014 |
| 56 | Ga0466719_530996 | 3300042606 | Bacteria | 6162 |
| 57 | Ga0466722_011139 | 3300042609 | Bacteria | 15871 |
| 58 | Ga0466690_044794 | 3300042590 | Bacteria | 30063 |
| 59 | Ga0466690_153982 | 3300042590 | Bacteria | 10875 |
| 60 | Ga0466696_184153 | 3300042596 | Bacteria | 23807 |
| 61 | Ga0466696_209147 | 3300042596 | Bacteria | 9085 |
| 62 | Ga0466701_000462 | 3300042598 | Bacteria | 39838 |
| 63 | JGI24702J35022_10080083 | 3300002462 | Bacteria | 1769 |
| 64 | Ga0466703_334186 | 3300042636 | Bacteria | 5862 |
| 65 | Ga0466704_619305 | 3300042643 | Bacteria | 20556 |
| 66 | Ga0466709_356993 | 3300042648 | Bacteria | 3840 |
| 67 | Ga0466708_159923 | 3300042652 | Bacteria | 9701 |
| 68 | Ga0466727_026754 | 3300042655 | Bacteria | 30729 |
| 69 | Ga0466727_312158 | 3300042655 | Bacteria | 1062 |
| 70 | Ga0466711_091199 | 3300042615 | Unclassified | 1832 |
| 71 | Ga0466711_130139 | 3300042615 | Bacteria | 18313 |
| 72 | Ga0466715_276311 | 3300042616 | Bacteria | 1216 |
| 73 | Ga0466733_091434 | 3300042659 | Bacteria | 42297 |
| 74 | Ga0466707_191749 | 3300042601 | Bacteria | 9576 |
| 75 | Ga0466707_250770 | 3300042601 | Bacteria | 73510 |
| 76 | Ga0466713_091501 | 3300042602 | Unclassified | 5060 |
| 77 | Ga0466713_113185 | 3300042602 | Bacteria | 29253 |
| 78 | Ga0466714_093285 | 3300042603 | Bacteria | 105352 |
| 79 | Ga0466719_212996 | 3300042606 | Bacteria | 10412 |
| 80 | Ga0466719_225658 | 3300042606 | Bacteria | 39861 |
| 81 | Ga0466722_164504 | 3300042609 | Bacteria | 6910 |
| 82 | Ga0466722_265026 | 3300042609 | Bacteria | 9591 |
| 83 | Ga0466691_092912 | 3300042593 | Bacteria | 10068 |
| 84 | Ga0466696_328265 | 3300042596 | Bacteria | 8342 |
| 85 | IMNBL1DRAFT_c0009282 | 3300000062 | Unclassified | 4875 |
| 86 | JGI24702J35022_10040062 | 3300002462 | Bacteria | 2499 |
| 87 | Ga0068302_10131971 | 3300005071 | Bacteria | 3993 |
| 88 | Ga0072941_1431240 | 3300005201 | Bacteria | 2487 |
| 89 | Ga0466703_103291 | 3300042636 | Bacteria | 4226 |
| 90 | Ga0466703_266565 | 3300042636 | Unclassified | 2316 |
| 91 | Ga0466704_414956 | 3300042643 | Unclassified | 4769 |
| 92 | Ga0466708_205913 | 3300042652 | Bacteria | 3310 |
| 93 | Ga0123356_10494286 | 3300010049 | Bacteria | 1378 |
| 94 | Ga0466711_114539 | 3300042615 | Bacteria | 11718 |
| 95 | Ga0466715_211123 | 3300042616 | Bacteria | 56208 |
| 96 | Ga0466723_168018 | 3300042618 | Bacteria | 1255 |
| 97 | Ga0466726_075473 | 3300042619 | Bacteria | 4685 |
| 98 | Ga0466733_000712 | 3300042659 | Bacteria | 18066 |
| 99 | Ga0466713_012810 | 3300042602 | Bacteria | 8100 |
| 100 | Ga0466716_092980 | 3300042605 | Bacteria | 25359 |
| 101 | Ga0466716_206135 | 3300042605 | Bacteria | 4505 |
| 102 | Ga0466719_421828 | 3300042606 | Bacteria | 7147 |
| 103 | Ga0466692_066865 | 3300042591 | Bacteria | 168349 |
| 104 | Ga0466691_032553 | 3300042593 | Bacteria | 36698 |
| 105 | 2227294677 | 2225789004 | Bacteria | 6670 |
| 106 | JGI24702J35022_10002516 | 3300002462 | Bacteria | 11162 |
| 107 | Ga0068302_10066325 | 3300005071 | Bacteria | 9904 |
| 108 | Ga0466697_113704 | 3300042611 | Bacteria | 4120 |
| 109 | Ga0466705_011533 | 3300042612 | Bacteria | 8084 |
| 110 | Ga0466735_040633 | 3300042624 | Bacteria | 3560 |
| 111 | Ga0466703_124552 | 3300042636 | Bacteria | 5782 |
| 112 | Ga0466703_295196 | 3300042636 | Unclassified | 1596 |
| 113 | Ga0466704_207298 | 3300042643 | Bacteria | 9662 |
| 114 | Ga0466727_060829 | 3300042655 | Bacteria | 2595 |
| 115 | Ga0466727_248808 | 3300042655 | Bacteria | 9568 |
| 116 | Ga0123355_10001507 | 3300009826 | Bacteria | 32473 |
| 117 | Ga0466723_067547 | 3300042618 | Bacteria | 33416 |
| 118 | Ga0466733_038286 | 3300042659 | Bacteria | 266317 |
| 119 | Ga0466733_190493 | 3300042659 | Bacteria | 3597 |
| 120 | Ga0466707_062583 | 3300042601 | Bacteria | 4704 |
| 121 | Ga0466722_000863 | 3300042609 | Bacteria | 7989 |
| 122 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 123 | Ga0264413_146741 | 3300024493 | Bacteria | 2698 |
| 124 | Ga0466690_272494 | 3300042590 | Bacteria | 17538 |
| 125 | Ga0466696_083161 | 3300042596 | Bacteria | 1700 |
| 126 | Ga0466696_453482 | 3300042596 | Bacteria | 3491 |
| 127 | 2227480231 | 2225789004 | Bacteria | 4457 |
| 128 | Ga0466703_066927 | 3300042636 | Bacteria | 11086 |
| 129 | Ga0466704_322453 | 3300042643 | Bacteria | 4032 |
| 130 | Ga0466708_119412 | 3300042652 | Bacteria | 8069 |
| 131 | Ga0466708_314609 | 3300042652 | Bacteria | 13098 |
| 132 | Ga0123353_10214715 | 3300010167 | Bacteria | 3014 |
| 133 | Ga0123353_10397383 | 3300010167 | Bacteria | 2053 |
| 134 | Ga0466715_501506 | 3300042616 | Bacteria | 19563 |
| 135 | Ga0466726_264804 | 3300042619 | Bacteria | 4124 |
| 136 | Ga0466707_280950 | 3300042601 | Bacteria | 2352 |
| 137 | Ga0466713_029359 | 3300042602 | Bacteria | 15220 |
| 138 | Ga0466713_048155 | 3300042602 | Unclassified | 1852 |
| 139 | Ga0466716_147180 | 3300042605 | Unclassified | 4701 |
| 140 | Ga0466716_280844 | 3300042605 | Bacteria | 11537 |
| 141 | Ga0466690_206183 | 3300042590 | Bacteria | 11943 |
| 142 | Ga0466692_057186 | 3300042591 | Bacteria | 28674 |
| 143 | Ga0466691_141686 | 3300042593 | Bacteria | 16585 |
| 144 | Ga0466696_143446 | 3300042596 | Bacteria | 6203 |
| 145 | IMNBL1DRAFT_c0000891 | 3300000062 | Bacteria | 23227 |
| 146 | Ga0068305_10009948 | 3300005083 | Bacteria | 7080 |
| 147 | Ga0466705_065698 | 3300042612 | Bacteria | 3910 |
| 148 | Ga0466702_297466 | 3300042635 | Bacteria | 1718 |
| 149 | Ga0466703_138346 | 3300042636 | Bacteria | 1256 |
| 150 | Ga0466703_387371 | 3300042636 | Bacteria | 3085 |
| 151 | Ga0466704_200953 | 3300042643 | Bacteria | 4997 |
| 152 | Ga0466727_100832 | 3300042655 | Bacteria | 5675 |
| 153 | Ga0123356_10081715 | 3300010049 | Bacteria | 3058 |
| 154 | Ga0466711_268760 | 3300042615 | Bacteria | 28251 |
| 155 | Ga0466715_360800 | 3300042616 | Bacteria | 3246 |
| 156 | Ga0466706_181290 | 3300042599 | Bacteria | 2941 |
| 157 | Ga0466707_112391 | 3300042601 | Bacteria | 11861 |
| 158 | Ga0466707_227261 | 3300042601 | Bacteria | 1980 |
| 159 | Ga0466713_019678 | 3300042602 | Bacteria | 71467 |
| 160 | Ga0466713_131403 | 3300042602 | Bacteria | 18174 |
| 161 | Ga0466716_291493 | 3300042605 | Bacteria | 16470 |
| 162 | Ga0466716_292762 | 3300042605 | Bacteria | 3372 |
| 163 | Ga0466722_187401 | 3300042609 | Bacteria | 1939 |
| 164 | Ga0265387_1005084 | 3300024582 | Bacteria | 1778 |
| 165 | Ga0466690_098746 | 3300042590 | Bacteria | 7296 |
| 166 | Ga0466690_107536 | 3300042590 | Bacteria | 3212 |
| 167 | Ga0466696_450515 | 3300042596 | Bacteria | 5870 |
| 168 | Ga0466705_107217 | 3300042612 | Bacteria | 14176 |
| 169 | Ga0466735_004921 | 3300042624 | Bacteria | 1554 |
| 170 | Ga0466735_047548 | 3300042624 | Bacteria | 1999 |
| 171 | Ga0466702_145326 | 3300042635 | Bacteria | 1597 |
| 172 | Ga0466703_059920 | 3300042636 | Bacteria | 1324 |
| 173 | Ga0466703_097625 | 3300042636 | Bacteria | 1578 |
| 174 | Ga0466703_194794 | 3300042636 | Bacteria | 11339 |
| 175 | Ga0466704_136281 | 3300042643 | Unclassified | 2866 |
| 176 | Ga0466704_233898 | 3300042643 | Bacteria | 5135 |
| 177 | Ga0466709_146482 | 3300042648 | Bacteria | 25195 |
| 178 | Ga0466727_344118 | 3300042655 | Bacteria | 13362 |
| 179 | Ga0466711_352181 | 3300042615 | Bacteria | 6092 |
| 180 | Ga0466715_629189 | 3300042616 | Unclassified | 2280 |
| 181 | Ga0466723_233783 | 3300042618 | Bacteria | 3345 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.