Protein Family IF09244
Metagenome
Isolate
401
Members
127
Samples
338
Scaffolds
427.98
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_298468|Ga0466703_298468_4188_5684
- Length
- 498 aa
- Sequence
- MFGIHNASPEETWTCKRTPFGGEKDTPLPSLGRKRVRPGTLKEMVWRNSKLSHTFVLLSSKQKFNIYTMNFVEELKWRGMIHDLMPGTEEQLQKEMTSAYVGIDPTADSLHIGHLVGVMMLKHFQSAGHRPIALVGGATGMIGDPSMKSAERNLLDEATLRHNQESIKKQLTKFLDFDSNAPNAAKMVNNYDWMKEYLFLDFIRDIGKHITVNYMMAKDSVKKRLSNESNVGMSFTEFSYQLLQGYDFLYLYQHEGCRLQMGGSDQWGNITTGAELIRRKEGGEAFALVCPLITKADGTKFGKTESGNVWLDRRYTSPYAFYQFWLNVSDEDAAKYIKIFTALGKEEISSIEEEQAAAPHLRPLQKRLAREITTMVHSAEDYETAVEASNMLFGNSTSESLRKLDEETLLAVLDGVPRFDISRDELSAGIKAVELLSVKASVFPSKGEMRKLTLSGGVSINKEKLSDPETVINTTFLVNGKYLLAQKGRKNYYLLIAR
Sample Types
Isolate
15.7%
Metagenome
84.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
26.2%
Termitidae
23.0%
Unclassified
18.9%
Kalotermitidae
11.5%
Rhinotermitidae
3.3%
Culicidae
3.3%
Passalidae
2.5%
Elmidae
2.5%
Termopsidae
2.5%
Daphniidae
0.8%
Hodotermitidae
0.8%
Pyralidae
0.8%
Armadillidiidae
0.8%
Cambaridae
0.8%
Tenebrionidae
0.8%
Nephropidae
0.8%
Drosophilidae
0.8%
Taxonomy
Archaea
0
Bacteria
397
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 2 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 3 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 4 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 5 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 6 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 7 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 8 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 9 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 10 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 21 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 22 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 23 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 24 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 25 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 26 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 27 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 28 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 29 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 30 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 31 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 32 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 35 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 36 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 39 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 40 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 43 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 44 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 45 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 46 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 47 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 48 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 49 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 50 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 51 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 52 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 53 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 54 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 55 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 56 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 57 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 58 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 59 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 60 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 61 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 62 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 63 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 64 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 65 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 66 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 67 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 68 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 69 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 70 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 71 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 72 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 73 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 74 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 75 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 76 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 77 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 78 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 79 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 80 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 81 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 82 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 83 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 84 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 85 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 86 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 87 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 88 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 89 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 90 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 91 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 92 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 93 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 94 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 95 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 96 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 97 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 98 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 99 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 100 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 101 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 102 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 103 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 104 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 105 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 106 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 107 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 108 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 109 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 110 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 111 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 112 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 113 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 114 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 115 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 116 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 117 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 118 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 119 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 120 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 121 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 122 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 123 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 124 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 125 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 126 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 127 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_059575 | 3300042612 | Bacteria | 12605 |
| 2 | Ga0466733_039051 | 3300042659 | Bacteria | 7800 |
| 3 | Ga0466735_217359 | 3300042624 | Bacteria | 7634 |
| 4 | Ga0466703_021603 | 3300042636 | Bacteria | 26593 |
| 5 | Ga0466703_293072 | 3300042636 | Bacteria | 3431 |
| 6 | Ga0466704_093316 | 3300042643 | Bacteria | 24160 |
| 7 | Ga0466709_221860 | 3300042648 | Bacteria | 264751 |
| 8 | Ga0466708_152497 | 3300042652 | Bacteria | 19960 |
| 9 | Ga0466708_390277 | 3300042652 | Bacteria | 3530 |
| 10 | Ga0466727_022522 | 3300042655 | Bacteria | 13838 |
| 11 | Ga0123353_10001236 | 3300010167 | Bacteria | 31329 |
| 12 | Ga0123354_10037795 | 3300010882 | Bacteria | 7510 |
| 13 | Ga0466710_034227 | 3300042613 | Bacteria | 2952 |
| 14 | Ga0466711_214095 | 3300042615 | Bacteria | 12354 |
| 15 | Ga0466711_495724 | 3300042615 | Bacteria | 12054 |
| 16 | Ga0466723_074859 | 3300042618 | Bacteria | 49235 |
| 17 | Ga0466723_077539 | 3300042618 | Bacteria | 8881 |
| 18 | Ga0466723_370819 | 3300042618 | Bacteria | 1797 |
| 19 | Ga0466728_255251 | 3300042620 | Bacteria | 107081 |
| 20 | Ga0466701_097473 | 3300042598 | Bacteria | 1691 |
| 21 | Ga0466706_135439 | 3300042599 | Bacteria | 3084 |
| 22 | Ga0466713_018045 | 3300042602 | Bacteria | 10429 |
| 23 | Ga0466713_064405 | 3300042602 | Bacteria | 152501 |
| 24 | Ga0466714_052802 | 3300042603 | Bacteria | 11571 |
| 25 | Ga0466716_026253 | 3300042605 | Bacteria | 2891 |
| 26 | Ga0466716_415147 | 3300042605 | Bacteria | 4391 |
| 27 | Ga0466722_178845 | 3300042609 | Bacteria | 79493 |
| 28 | Ga0466722_197078 | 3300042609 | Bacteria | 10013 |
| 29 | Ga0466690_015557 | 3300042590 | Bacteria | 2521 |
| 30 | Ga0466692_095605 | 3300042591 | Bacteria | 21856 |
| 31 | Ga0466691_031198 | 3300042593 | Bacteria | 19421 |
| 32 | Ga0466691_088539 | 3300042593 | Bacteria | 4545 |
| 33 | Ga0466691_149507 | 3300042593 | Bacteria | 14341 |
| 34 | Ga0466695_188999 | 3300042595 | Bacteria | 2507 |
| 35 | 2227035900 | 2225789003 | Unclassified | 23228 |
| 36 | 2227480171 | 2225789004 | Bacteria | 93917 |
| 37 | IMNBL1DRAFT_c0003842 | 3300000062 | Bacteria | 9355 |
| 38 | JGI24702J35022_10024571 | 3300002462 | Bacteria | 3254 |
| 39 | JGI24702J35022_10062551 | 3300002462 | Bacteria | 1993 |
| 40 | Ga0068305_10045443 | 3300005083 | Bacteria | 11791 |
| 41 | Ga0466697_179409 | 3300042611 | Bacteria | 152612 |
| 42 | Ga0466733_079865 | 3300042659 | Bacteria | 2683 |
| 43 | Ga0466733_129874 | 3300042659 | Bacteria | 9674 |
| 44 | Ga0466731_092326 | 3300042622 | Bacteria | 1563 |
| 45 | Ga0466703_029177 | 3300042636 | Bacteria | 4058 |
| 46 | Ga0466703_327279 | 3300042636 | Bacteria | 10697 |
| 47 | Ga0466708_121014 | 3300042652 | Bacteria | 4877 |
| 48 | Ga0466727_132542 | 3300042655 | Bacteria | 10825 |
| 49 | Ga0123355_10000036 | 3300009826 | Bacteria | 135537 |
| 50 | Ga0123353_10000592 | 3300010167 | Bacteria | 44307 |
| 51 | Ga0123353_10001805 | 3300010167 | Bacteria | 26319 |
| 52 | Ga0123354_10007115 | 3300010882 | Bacteria | 16753 |
| 53 | Ga0466715_149795 | 3300042616 | Bacteria | 34010 |
| 54 | Ga0466715_162453 | 3300042616 | Bacteria | 2705 |
| 55 | Ga0466726_054222 | 3300042619 | Bacteria | 20056 |
| 56 | Ga0466728_116286 | 3300042620 | Bacteria | 14463 |
| 57 | Ga0466728_213489 | 3300042620 | Bacteria | 40173 |
| 58 | Ga0466728_304435 | 3300042620 | Bacteria | 29742 |
| 59 | Ga0466729_076873 | 3300042621 | Bacteria | 35472 |
| 60 | Ga0466706_004139 | 3300042599 | Bacteria | 15773 |
| 61 | Ga0466706_014807 | 3300042599 | Bacteria | 31983 |
| 62 | Ga0466706_109980 | 3300042599 | Bacteria | 32685 |
| 63 | Ga0466706_113167 | 3300042599 | Bacteria | 48207 |
| 64 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 65 | Ga0466700_090275 | 3300042600 | Bacteria | 6737 |
| 66 | Ga0466713_038350 | 3300042602 | Bacteria | 35416 |
| 67 | Ga0466714_165770 | 3300042603 | Bacteria | 1901 |
| 68 | Ga0466716_341974 | 3300042605 | Bacteria | 17212 |
| 69 | Ga0466719_008338 | 3300042606 | Bacteria | 1718 |
| 70 | Ga0466722_245435 | 3300042609 | Bacteria | 23596 |
| 71 | Ga0466656_028610 | 3300042550 | Bacteria | 15940 |
| 72 | Ga0466656_034129 | 3300042550 | Bacteria | 1589 |
| 73 | Ga0466657_078090 | 3300042582 | Bacteria | 22905 |
| 74 | Ga0466690_292670 | 3300042590 | Bacteria | 8164 |
| 75 | Ga0466691_015032 | 3300042593 | Bacteria | 6276 |
| 76 | Ga0466696_137777 | 3300042596 | Bacteria | 43562 |
| 77 | Ga0466699_375390 | 3300042597 | Bacteria | 1730 |
| 78 | Ga0466701_009199 | 3300042598 | Bacteria | 86375 |
| 79 | 2227464933 | 2225789004 | Bacteria | 5215 |
| 80 | 2227491301 | 2225789004 | Bacteria | 20480 |
| 81 | IMNBL1DRAFT_c0002640 | 3300000062 | Bacteria | 12272 |
| 82 | JGI24702J35022_10001651 | 3300002462 | Bacteria | 13859 |
| 83 | JGI24705J35276_12235659 | 3300002504 | Bacteria | 6797 |
| 84 | JGI24696J40584_12954123 | 3300002834 | Bacteria | 2587 |
| 85 | JGI24696J40584_12961270 | 3300002834 | Bacteria | 12872 |
| 86 | Ga0068305_10003747 | 3300005083 | Bacteria | 16521 |
| 87 | Ga0068305_10175530 | 3300005083 | Bacteria | 1899 |
| 88 | Ga0466705_321458 | 3300042612 | Bacteria | 23775 |
| 89 | Ga0466733_004143 | 3300042659 | Bacteria | 13018 |
| 90 | Ga0466733_149513 | 3300042659 | Bacteria | 8207 |
| 91 | Ga0466704_194822 | 3300042643 | Bacteria | 11072 |
| 92 | Ga0466708_314036 | 3300042652 | Bacteria | 24831 |
| 93 | Ga0466727_328304 | 3300042655 | Bacteria | 2062 |
| 94 | Ga0123355_10000115 | 3300009826 | Bacteria | 90475 |
| 95 | Ga0123356_10002203 | 3300010049 | Bacteria | 20961 |
| 96 | Ga0123356_10231293 | 3300010049 | Bacteria | 1913 |
| 97 | Ga0123353_10013864 | 3300010167 | Bacteria | 11577 |
| 98 | Ga0123353_10026317 | 3300010167 | Bacteria | 8882 |
| 99 | Ga0123353_10038396 | 3300010167 | Bacteria | 7525 |
| 100 | Ga0466710_218346 | 3300042613 | Bacteria | 25228 |
| 101 | Ga0466711_057542 | 3300042615 | Bacteria | 70908 |
| 102 | Ga0466715_491159 | 3300042616 | Bacteria | 21907 |
| 103 | Ga0466723_099283 | 3300042618 | Bacteria | 27764 |
| 104 | Ga0466726_094643 | 3300042619 | Unclassified | 11326 |
| 105 | Ga0466726_493254 | 3300042619 | Bacteria | 5303 |
| 106 | Ga0466728_374045 | 3300042620 | Bacteria | 10374 |
| 107 | Ga0466706_078679 | 3300042599 | Bacteria | 8059 |
| 108 | Ga0466706_117849 | 3300042599 | Bacteria | 2734 |
| 109 | Ga0466706_218002 | 3300042599 | Bacteria | 15756 |
| 110 | Ga0466706_237897 | 3300042599 | Bacteria | 14140 |
| 111 | Ga0466700_492960 | 3300042600 | Bacteria | 3949 |
| 112 | Ga0466707_236921 | 3300042601 | Bacteria | 26268 |
| 113 | Ga0466714_004323 | 3300042603 | Bacteria | 16717 |
| 114 | Ga0466714_129213 | 3300042603 | Bacteria | 9225 |
| 115 | Ga0466716_139041 | 3300042605 | Bacteria | 9912 |
| 116 | Ga0466719_134223 | 3300042606 | Bacteria | 5807 |
| 117 | Ga0466719_401419 | 3300042606 | Bacteria | 1563 |
| 118 | Ga0466690_068159 | 3300042590 | Bacteria | 11159 |
| 119 | Ga0466690_078338 | 3300042590 | Bacteria | 12258 |
| 120 | Ga0466690_427464 | 3300042590 | Bacteria | 23231 |
| 121 | Ga0466692_150222 | 3300042591 | Bacteria | 2723 |
| 122 | Ga0466691_038526 | 3300042593 | Unclassified | 6485 |
| 123 | Ga0466694_261427 | 3300042594 | Bacteria | 10303 |
| 124 | Ga0466696_105336 | 3300042596 | Bacteria | 23999 |
| 125 | Ga0466696_151110 | 3300042596 | Bacteria | 63406 |
| 126 | Ga0466696_257433 | 3300042596 | Bacteria | 4375 |
| 127 | Ga0466696_380941 | 3300042596 | Bacteria | 4333 |
| 128 | IMNBL1DRAFT_c0000010 | 3300000062 | Bacteria | 201282 |
| 129 | JGI24695J34938_10048347 | 3300002450 | Bacteria | 1874 |
| 130 | JGI24702J35022_10040711 | 3300002462 | Bacteria | 2478 |
| 131 | Ga0068305_10220808 | 3300005083 | Bacteria | 3026 |
| 132 | Ga0466705_007373 | 3300042612 | Bacteria | 4454 |
| 133 | Ga0466705_145571 | 3300042612 | Bacteria | 4434 |
| 134 | Ga0466735_057205 | 3300042624 | Bacteria | 2006 |
| 135 | Ga0466735_222707 | 3300042624 | Bacteria | 1864 |
| 136 | Ga0466735_235166 | 3300042624 | Bacteria | 8885 |
| 137 | Ga0466703_084851 | 3300042636 | Bacteria | 16965 |
| 138 | Ga0466703_232708 | 3300042636 | Bacteria | 6408 |
| 139 | Ga0466704_134166 | 3300042643 | Bacteria | 7333 |
| 140 | Ga0466709_232342 | 3300042648 | Bacteria | 4867 |
| 141 | Ga0466709_405010 | 3300042648 | Bacteria | 7125 |
| 142 | Ga0466727_050092 | 3300042655 | Bacteria | 13883 |
| 143 | Ga0123355_10018124 | 3300009826 | Bacteria | 11151 |
| 144 | Ga0466711_040951 | 3300042615 | Bacteria | 13131 |
| 145 | Ga0466711_130139 | 3300042615 | Bacteria | 18313 |
| 146 | Ga0466711_181635 | 3300042615 | Bacteria | 6512 |
| 147 | Ga0466711_472603 | 3300042615 | Bacteria | 5322 |
| 148 | Ga0466715_346660 | 3300042616 | Bacteria | 2447 |
| 149 | Ga0466723_194979 | 3300042618 | Bacteria | 3313 |
| 150 | Ga0466723_320922 | 3300042618 | Bacteria | 9908 |
| 151 | Ga0466726_031004 | 3300042619 | Bacteria | 11891 |
| 152 | Ga0466726_343693 | 3300042619 | Bacteria | 8385 |
| 153 | Ga0466726_431522 | 3300042619 | Bacteria | 5720 |
| 154 | Ga0466700_343638 | 3300042600 | Bacteria | 2148 |
| 155 | Ga0466707_177818 | 3300042601 | Bacteria | 1503 |
| 156 | Ga0466707_365099 | 3300042601 | Bacteria | 8787 |
| 157 | Ga0466713_061789 | 3300042602 | Bacteria | 88378 |
| 158 | Ga0466716_116329 | 3300042605 | Bacteria | 6123 |
| 159 | Ga0160457_1000016 | 3300012858 | Bacteria | 412496 |
| 160 | Ga0265387_1000835 | 3300024582 | Bacteria | 4691 |
| 161 | Ga0466657_195360 | 3300042582 | Bacteria | 6806 |
| 162 | Ga0466690_331838 | 3300042590 | Bacteria | 6664 |
| 163 | Ga0466694_387774 | 3300042594 | Bacteria | 4240 |
| 164 | Ga0466695_061772 | 3300042595 | Bacteria | 1994 |
| 165 | Ga0466695_328697 | 3300042595 | Bacteria | 34610 |
| 166 | Ga0466696_193610 | 3300042596 | Bacteria | 4057 |
| 167 | IMNBL1DRAFT_c0007528 | 3300000062 | Bacteria | 5707 |
| 168 | JGI24702J35022_10002083 | 3300002462 | Bacteria | 12345 |
| 169 | Ga0068305_10048315 | 3300005083 | Bacteria | 14333 |
| 170 | Ga0068305_10162465 | 3300005083 | Bacteria | 4049 |
| 171 | Ga0466732_100665 | 3300042656 | Bacteria | 2928 |
| 172 | Ga0466733_055105 | 3300042659 | Bacteria | 10739 |
| 173 | Ga0466733_208758 | 3300042659 | Bacteria | 10928 |
| 174 | Ga0466735_205316 | 3300042624 | Bacteria | 1574 |
| 175 | Ga0466703_107774 | 3300042636 | Bacteria | 3042 |
| 176 | Ga0466703_277214 | 3300042636 | Bacteria | 3050 |
| 177 | Ga0466704_070099 | 3300042643 | Bacteria | 12192 |
| 178 | Ga0466704_093332 | 3300042643 | Bacteria | 14211 |
| 179 | Ga0466704_492829 | 3300042643 | Bacteria | 69142 |
| 180 | Ga0466724_62436 | 3300042649 | Bacteria | 5014 |
| 181 | Ga0466708_060869 | 3300042652 | Bacteria | 32106 |
| 182 | Ga0466708_327904 | 3300042652 | Bacteria | 35728 |
| 183 | Ga0123353_10128433 | 3300010167 | Bacteria | 4070 |
| 184 | Ga0466705_413762 | 3300042612 | Bacteria | 15324 |
| 185 | Ga0466711_433559 | 3300042615 | Bacteria | 5254 |
| 186 | Ga0466715_010385 | 3300042616 | Bacteria | 8348 |
| 187 | Ga0466715_068078 | 3300042616 | Bacteria | 6536 |
| 188 | Ga0466715_515528 | 3300042616 | Bacteria | 19435 |
| 189 | Ga0466706_126480 | 3300042599 | Bacteria | 6518 |
| 190 | Ga0466706_151978 | 3300042599 | Bacteria | 59315 |
| 191 | Ga0466707_345434 | 3300042601 | Bacteria | 28806 |
| 192 | Ga0466713_089471 | 3300042602 | Bacteria | 15315 |
| 193 | Ga0466714_069461 | 3300042603 | Bacteria | 5575 |
| 194 | Ga0466714_162492 | 3300042603 | Bacteria | 10812 |
| 195 | Ga0466717_130950 | 3300042604 | Bacteria | 2542 |
| 196 | Ga0466719_559848 | 3300042606 | Bacteria | 1765 |
| 197 | Ga0160448_106350 | 3300012854 | Bacteria | 2967 |
| 198 | Ga0466657_015097 | 3300042582 | Bacteria | 157741 |
| 199 | Ga0466691_067214 | 3300042593 | Bacteria | 14676 |
| 200 | Ga0466696_091632 | 3300042596 | Bacteria | 13653 |
| 201 | Ga0466696_104985 | 3300042596 | Bacteria | 6383 |
| 202 | Ga0466696_191055 | 3300042596 | Bacteria | 25014 |
| 203 | 2227507962 | 2225789004 | Bacteria | 64470 |
| 204 | IMNBL1DRAFT_c0000159 | 3300000062 | Bacteria | 59691 |
| 205 | JGI24705J35276_12238422 | 3300002504 | Bacteria | 21566 |
| 206 | Ga0105005_1014461 | 3300007505 | Bacteria | 7420 |
| 207 | Ga0123357_10001030 | 3300009784 | Bacteria | 28577 |
| 208 | Ga0123357_10002964 | 3300009784 | Bacteria | 19194 |
| 209 | Ga0466705_014939 | 3300042612 | Bacteria | 12251 |
| 210 | Ga0466733_019484 | 3300042659 | Bacteria | 2696 |
| 211 | Ga0466733_098937 | 3300042659 | Bacteria | 150442 |
| 212 | Ga0466735_048352 | 3300042624 | Bacteria | 4396 |
| 213 | Ga0466704_071004 | 3300042643 | Bacteria | 15286 |
| 214 | Ga0466709_180554 | 3300042648 | Bacteria | 66844 |
| 215 | Ga0466725_105013 | 3300042654 | Bacteria | 2881 |
| 216 | Ga0123356_10077641 | 3300010049 | Bacteria | 3132 |
| 217 | Ga0123353_10016761 | 3300010167 | Bacteria | 10726 |
| 218 | Ga0123353_10019427 | 3300010167 | Bacteria | 10096 |
| 219 | Ga0123353_10067501 | 3300010167 | Bacteria | 5743 |
| 220 | Ga0123353_10362584 | 3300010167 | Bacteria | 2177 |
| 221 | Ga0466711_283488 | 3300042615 | Bacteria | 4205 |
| 222 | Ga0466715_033351 | 3300042616 | Bacteria | 10959 |
| 223 | Ga0466723_163950 | 3300042618 | Bacteria | 9859 |
| 224 | Ga0466726_027396 | 3300042619 | Bacteria | 3862 |
| 225 | Ga0466728_105347 | 3300042620 | Bacteria | 39540 |
| 226 | Ga0466706_085954 | 3300042599 | Bacteria | 15828 |
| 227 | Ga0466706_276180 | 3300042599 | Bacteria | 65753 |
| 228 | Ga0466707_228096 | 3300042601 | Bacteria | 68140 |
| 229 | Ga0466713_017127 | 3300042602 | Bacteria | 94881 |
| 230 | Ga0466714_012997 | 3300042603 | Bacteria | 5019 |
| 231 | Ga0466717_158451 | 3300042604 | Bacteria | 3399 |
| 232 | Ga0466716_224354 | 3300042605 | Bacteria | 12040 |
| 233 | Ga0466716_325289 | 3300042605 | Bacteria | 6987 |
| 234 | Ga0466719_036510 | 3300042606 | Bacteria | 25328 |
| 235 | Ga0160447_107382 | 3300012849 | Unclassified | 2760 |
| 236 | Ga0466656_269934 | 3300042550 | Bacteria | 13790 |
| 237 | Ga0466696_082914 | 3300042596 | Bacteria | 4205 |
| 238 | Ga0466696_336611 | 3300042596 | Bacteria | 7148 |
| 239 | Ga0466696_478182 | 3300042596 | Bacteria | 3887 |
| 240 | 2227303012 | 2225789004 | Bacteria | 29133 |
| 241 | Ga0068305_10010366 | 3300005083 | Bacteria | 14181 |
| 242 | Ga0068305_10069130 | 3300005083 | Bacteria | 5295 |
| 243 | Ga0072941_1100974 | 3300005201 | Bacteria | 5340 |
| 244 | Ga0466705_106736 | 3300042612 | Bacteria | 2822 |
| 245 | Ga0466731_257050 | 3300042622 | Bacteria | 3072 |
| 246 | Ga0466735_024499 | 3300042624 | Bacteria | 6343 |
| 247 | Ga0466703_298468 | 3300042636 | Bacteria | 7799 |
| 248 | Ga0466704_572180 | 3300042643 | Bacteria | 7701 |
| 249 | Ga0466709_217396 | 3300042648 | Bacteria | 210619 |
| 250 | Ga0466709_240296 | 3300042648 | Bacteria | 17660 |
| 251 | Ga0466709_317515 | 3300042648 | Bacteria | 8096 |
| 252 | Ga0466708_350654 | 3300042652 | Bacteria | 14045 |
| 253 | Ga0466708_375612 | 3300042652 | Bacteria | 3143 |
| 254 | Ga0466727_322298 | 3300042655 | Bacteria | 3861 |
| 255 | Ga0466710_303218 | 3300042613 | Bacteria | 4042 |
| 256 | Ga0466711_302376 | 3300042615 | Bacteria | 10330 |
| 257 | Ga0466715_372014 | 3300042616 | Bacteria | 24656 |
| 258 | Ga0466715_465262 | 3300042616 | Bacteria | 8035 |
| 259 | Ga0466715_531437 | 3300042616 | Bacteria | 5453 |
| 260 | Ga0466723_230208 | 3300042618 | Bacteria | 14199 |
| 261 | Ga0466728_051767 | 3300042620 | Bacteria | 37660 |
| 262 | Ga0466728_268835 | 3300042620 | Bacteria | 15369 |
| 263 | Ga0466706_083186 | 3300042599 | Bacteria | 38961 |
| 264 | Ga0466706_268620 | 3300042599 | Bacteria | 4333 |
| 265 | Ga0466713_007778 | 3300042602 | Bacteria | 12808 |
| 266 | Ga0466713_017478 | 3300042602 | Bacteria | 15565 |
| 267 | Ga0466713_026512 | 3300042602 | Bacteria | 8351 |
| 268 | Ga0466713_130921 | 3300042602 | Bacteria | 9593 |
| 269 | Ga0466713_143519 | 3300042602 | Bacteria | 40408 |
| 270 | Ga0466716_176844 | 3300042605 | Bacteria | 4889 |
| 271 | Ga0466716_339746 | 3300042605 | Bacteria | 5291 |
| 272 | Ga0466716_473788 | 3300042605 | Bacteria | 5668 |
| 273 | Ga0466719_174860 | 3300042606 | Bacteria | 5343 |
| 274 | Ga0466721_147795 | 3300042608 | Bacteria | 3350 |
| 275 | Ga0466722_134773 | 3300042609 | Bacteria | 13714 |
| 276 | Ga0160446_100356 | 3300012835 | Bacteria | 24136 |
| 277 | Ga0466656_076173 | 3300042550 | Bacteria | 7364 |
| 278 | Ga0466692_178491 | 3300042591 | Bacteria | 61882 |
| 279 | Ga0466693_365248 | 3300042592 | Bacteria | 2354 |
| 280 | Ga0466696_357692 | 3300042596 | Bacteria | 9512 |
| 281 | Ga0466699_209013 | 3300042597 | Bacteria | 3148 |
| 282 | IMNBL1DRAFT_c0002954 | 3300000062 | Bacteria | 11297 |
| 283 | IMNBL1DRAFT_c0014991 | 3300000062 | Bacteria | 3385 |
| 284 | JGI24702J35022_10006956 | 3300002462 | Bacteria | 6505 |
| 285 | JGI24702J35022_10083793 | 3300002462 | Bacteria | 1729 |
| 286 | JGI24696J40584_12942435 | 3300002834 | Bacteria | 1741 |
| 287 | Ga0466697_110978 | 3300042611 | Bacteria | 2830 |
| 288 | Ga0466705_267995 | 3300042612 | Bacteria | 14205 |
| 289 | Ga0466705_377071 | 3300042612 | Bacteria | 2420 |
| 290 | Ga0466732_133440 | 3300042656 | Bacteria | 22850 |
| 291 | Ga0466733_059268 | 3300042659 | Bacteria | 25661 |
| 292 | Ga0466733_066099 | 3300042659 | Bacteria | 8312 |
| 293 | Ga0562377_0294 | 3300056842 | Bacteria | 105107 |
| 294 | Ga0466731_328667 | 3300042622 | Bacteria | 2711 |
| 295 | Ga0466735_050417 | 3300042624 | Bacteria | 2868 |
| 296 | Ga0466735_194568 | 3300042624 | Bacteria | 1812 |
| 297 | Ga0466703_156369 | 3300042636 | Bacteria | 4865 |
| 298 | Ga0466703_286277 | 3300042636 | Bacteria | 12375 |
| 299 | Ga0466709_227520 | 3300042648 | Bacteria | 3393 |
| 300 | Ga0466708_223497 | 3300042652 | Bacteria | 21983 |
| 301 | Ga0466727_016077 | 3300042655 | Bacteria | 15826 |
| 302 | Ga0466727_118674 | 3300042655 | Bacteria | 4257 |
| 303 | Ga0123356_10032008 | 3300010049 | Bacteria | 4923 |
| 304 | Ga0123353_10193904 | 3300010167 | Bacteria | 3204 |
| 305 | Ga0123353_10409280 | 3300010167 | Bacteria | 2015 |
| 306 | Ga0466711_045786 | 3300042615 | Bacteria | 34187 |
| 307 | Ga0466715_047082 | 3300042616 | Bacteria | 54165 |
| 308 | Ga0466715_376214 | 3300042616 | Bacteria | 11160 |
| 309 | Ga0466715_547196 | 3300042616 | Bacteria | 6782 |
| 310 | Ga0466723_143564 | 3300042618 | Bacteria | 3485 |
| 311 | Ga0466723_224284 | 3300042618 | Bacteria | 30693 |
| 312 | Ga0466723_373884 | 3300042618 | Bacteria | 6315 |
| 313 | Ga0466726_101301 | 3300042619 | Bacteria | 4853 |
| 314 | Ga0466729_167121 | 3300042621 | Bacteria | 12010 |
| 315 | Ga0466701_037634 | 3300042598 | Bacteria | 2328 |
| 316 | Ga0466706_056140 | 3300042599 | Bacteria | 4111 |
| 317 | Ga0466706_063485 | 3300042599 | Bacteria | 4314 |
| 318 | Ga0466707_262812 | 3300042601 | Bacteria | 10960 |
| 319 | Ga0466707_292001 | 3300042601 | Bacteria | 2477 |
| 320 | Ga0466707_311602 | 3300042601 | Bacteria | 7197 |
| 321 | Ga0466713_004082 | 3300042602 | Bacteria | 11197 |
| 322 | Ga0466713_064062 | 3300042602 | Bacteria | 3490 |
| 323 | Ga0466713_104239 | 3300042602 | Bacteria | 4237 |
| 324 | Ga0466713_154934 | 3300042602 | Bacteria | 14075 |
| 325 | Ga0466714_073532 | 3300042603 | Bacteria | 5091 |
| 326 | Ga0466716_067049 | 3300042605 | Bacteria | 4187 |
| 327 | Ga0466716_435797 | 3300042605 | Bacteria | 10182 |
| 328 | Ga0466722_264469 | 3300042609 | Bacteria | 3408 |
| 329 | Ga0160436_1003325 | 3300012861 | Bacteria | 3950 |
| 330 | Ga0466690_080200 | 3300042590 | Bacteria | 12268 |
| 331 | Ga0466691_197327 | 3300042593 | Bacteria | 32491 |
| 332 | Ga0466696_033053 | 3300042596 | Bacteria | 7600 |
| 333 | Ga0466696_034818 | 3300042596 | Bacteria | 34384 |
| 334 | Ga0466696_267466 | 3300042596 | Bacteria | 31793 |
| 335 | Ga0466696_377395 | 3300042596 | Bacteria | 3016 |
| 336 | Ga0466696_458409 | 3300042596 | Bacteria | 16905 |
| 337 | JGI24699J35502_11133354 | 3300002509 | Bacteria | 10038 |
| 338 | JGI24696J40584_12955325 | 3300002834 | Bacteria | 2811 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.