Protein Family IF09142
Metagenome
Isolate
370
Members
134
Samples
313
Scaffolds
274.15
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_104616|Ga0466703_104616_38_1054
- Length
- 338 aa
- Sequence
- MHSPSKRLPQKTSPQSGSLWTIITACGKRKVSLFPERIIRRQKFRFLFCITSGMHYLCGVKKQKNMSAAAKDDSRKVTTHRLIEMKQRGEKISMLTAYEYSMAKIIDQAGMDVILVGDSASNVMAGNITTLPITLDQMIYHGKSVMKAVKRALVVVDLPFGSYQGNSKEALASAIRVMKETYADCIKIEGGAEIKESVQRILSAGIPLMGHLGLTPQSINKFGTYAVRAREEAEAQKLMDDACLLEELGCFAVVLEKIPAELAARVADRLAIPAIGIGAGGGVDGQVLVMHDMLGINREFSPRFLRRYANLYEVITDSVQAYVKDVKNGDFPNEKEQY
Sample Types
Isolate
15.4%
Metagenome
84.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
20.5%
Blattidae
19.7%
Unclassified
11.5%
Kalotermitidae
11.5%
Formicidae
7.4%
Culicidae
6.6%
Elmidae
4.9%
Armadillidiidae
4.1%
Termopsidae
3.3%
Rhinotermitidae
3.3%
Drosophilidae
1.6%
Passalidae
1.6%
Hodotermitidae
0.8%
Daphniidae
0.8%
Apidae
0.8%
Cambaridae
0.8%
Tenebrionidae
0.8%
Taxonomy
Archaea
0
Bacteria
356
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 2 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 3 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 4 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 5 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 6 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 18 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 19 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 20 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 21 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 22 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 23 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 24 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 25 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 26 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 31 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 32 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 33 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 34 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 35 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 36 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 37 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 38 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 39 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 40 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 41 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 42 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 43 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 46 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 47 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 48 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 49 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 50 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 51 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 52 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 53 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 54 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 55 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 56 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 57 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 58 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 59 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 60 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 61 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 62 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 63 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 64 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 65 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 66 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 67 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 68 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 69 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 70 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 71 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 72 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 73 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 74 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 75 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 76 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 77 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 78 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 79 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 80 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 81 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 82 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 83 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 84 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 85 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 86 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 87 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 88 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 89 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 90 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 91 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 92 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 93 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 94 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 95 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 96 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 97 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 98 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 99 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 100 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 101 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 102 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 103 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 104 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 105 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 106 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 107 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 108 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 109 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 110 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 111 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 112 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 113 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 114 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 115 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 116 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 117 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 118 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 119 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 120 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 121 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 122 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 123 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 124 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 125 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 126 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 127 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 128 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 129 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 130 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 131 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 132 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 133 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 134 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_070490 | 3300042612 | Bacteria | 10131 |
| 2 | Ga0466732_293542 | 3300042656 | Bacteria | 1689 |
| 3 | Ga0466733_020905 | 3300042659 | Bacteria | 4289 |
| 4 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 5 | Ga0466712_087266 | 3300042614 | Bacteria | 1435 |
| 6 | Ga0466711_161125 | 3300042615 | Bacteria | 26115 |
| 7 | Ga0466711_228054 | 3300042615 | Bacteria | 4312 |
| 8 | Ga0466715_484472 | 3300042616 | Bacteria | 8507 |
| 9 | Ga0466723_077992 | 3300042618 | Bacteria | 6736 |
| 10 | Ga0466726_249034 | 3300042619 | Bacteria | 5436 |
| 11 | Ga0466726_266114 | 3300042619 | Bacteria | 14251 |
| 12 | Ga0123357_10031898 | 3300009784 | Bacteria | 7148 |
| 13 | Ga0123353_10000014 | 3300010167 | Bacteria | 204767 |
| 14 | Ga0123353_10042123 | 3300010167 | Bacteria | 7218 |
| 15 | Ga0123354_10076955 | 3300010882 | Unclassified | 4757 |
| 16 | Ga0160445_100170 | 3300012847 | Bacteria | 53357 |
| 17 | Ga0466690_167559 | 3300042590 | Bacteria | 4121 |
| 18 | Ga0466693_160325 | 3300042592 | Bacteria | 1786 |
| 19 | Ga0466691_095185 | 3300042593 | Bacteria | 18797 |
| 20 | Ga0466694_346359 | 3300042594 | Bacteria | 1965 |
| 21 | Ga0466696_253210 | 3300042596 | Bacteria | 201850 |
| 22 | IMNBL1DRAFT_c0000063 | 3300000062 | Bacteria | 97352 |
| 23 | Ga0466701_064539 | 3300042598 | Bacteria | 29676 |
| 24 | Ga0466707_100961 | 3300042601 | Bacteria | 8759 |
| 25 | Ga0466707_353711 | 3300042601 | Bacteria | 5750 |
| 26 | Ga0466713_048675 | 3300042602 | Bacteria | 16454 |
| 27 | Ga0466713_125887 | 3300042602 | Bacteria | 5675 |
| 28 | Ga0466714_050129 | 3300042603 | Bacteria | 5843 |
| 29 | Ga0466714_107167 | 3300042603 | Bacteria | 6826 |
| 30 | Ga0466716_210896 | 3300042605 | Unclassified | 4877 |
| 31 | Ga0466716_265441 | 3300042605 | Bacteria | 6117 |
| 32 | Ga0466735_137028 | 3300042624 | Unclassified | 3217 |
| 33 | Ga0466703_178270 | 3300042636 | Bacteria | 19207 |
| 34 | Ga0466704_049875 | 3300042643 | Bacteria | 80175 |
| 35 | Ga0466704_456075 | 3300042643 | Bacteria | 2331 |
| 36 | Ga0466724_17528 | 3300042649 | Bacteria | 18086 |
| 37 | Ga0466727_123502 | 3300042655 | Bacteria | 1791 |
| 38 | Ga0466705_248410 | 3300042612 | Unclassified | 4797 |
| 39 | Ga0466733_000288 | 3300042659 | Unclassified | 9696 |
| 40 | Ga0466733_021489 | 3300042659 | Bacteria | 4852 |
| 41 | Ga0466733_159769 | 3300042659 | Bacteria | 1716 |
| 42 | Ga0466715_251414 | 3300042616 | Bacteria | 11625 |
| 43 | Ga0466715_383603 | 3300042616 | Bacteria | 14690 |
| 44 | Ga0466715_409054 | 3300042616 | Bacteria | 33238 |
| 45 | Ga0466723_057399 | 3300042618 | Bacteria | 11577 |
| 46 | Ga0466728_019578 | 3300042620 | Bacteria | 68915 |
| 47 | Ga0466729_173332 | 3300042621 | Bacteria | 4413 |
| 48 | Ga0123357_10310605 | 3300009784 | Bacteria | 1575 |
| 49 | Ga0123356_10172399 | 3300010049 | Unclassified | 2175 |
| 50 | Ga0123353_10122441 | 3300010167 | Bacteria | 4181 |
| 51 | Ga0123353_10192729 | 3300010167 | Unclassified | 3215 |
| 52 | Ga0466691_032553 | 3300042593 | Bacteria | 36698 |
| 53 | Ga0466691_092528 | 3300042593 | Bacteria | 24266 |
| 54 | Ga0466696_075277 | 3300042596 | Bacteria | 17540 |
| 55 | Ga0466696_281809 | 3300042596 | Bacteria | 3030 |
| 56 | Ga0466696_396168 | 3300042596 | Bacteria | 1718 |
| 57 | Ga0466701_014922 | 3300042598 | Bacteria | 1268 |
| 58 | JGI24699J35502_11134197 | 3300002509 | Bacteria | 52215 |
| 59 | Ga0466701_068352 | 3300042598 | Bacteria | 11681 |
| 60 | Ga0466707_198557 | 3300042601 | Bacteria | 1098 |
| 61 | Ga0466707_216314 | 3300042601 | Bacteria | 20236 |
| 62 | Ga0466713_002209 | 3300042602 | Bacteria | 7525 |
| 63 | Ga0466713_078993 | 3300042602 | Bacteria | 19593 |
| 64 | Ga0466714_014051 | 3300042603 | Bacteria | 1082 |
| 65 | Ga0466714_027359 | 3300042603 | Bacteria | 4891 |
| 66 | Ga0466714_065282 | 3300042603 | Bacteria | 4966 |
| 67 | Ga0466714_115560 | 3300042603 | Unclassified | 30195 |
| 68 | Ga0466703_163774 | 3300042636 | Bacteria | 7066 |
| 69 | Ga0466703_378355 | 3300042636 | Bacteria | 1616 |
| 70 | Ga0466704_025387 | 3300042643 | Bacteria | 7783 |
| 71 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 72 | Ga0466727_081240 | 3300042655 | Bacteria | 1940 |
| 73 | Ga0466727_103847 | 3300042655 | Bacteria | 10449 |
| 74 | Ga0466697_089499 | 3300042611 | Bacteria | 34083 |
| 75 | Ga0466733_035383 | 3300042659 | Bacteria | 60826 |
| 76 | Ga0466733_082103 | 3300042659 | Bacteria | 11088 |
| 77 | Ga0466705_431642 | 3300042612 | Bacteria | 10302 |
| 78 | Ga0466726_030784 | 3300042619 | Bacteria | 13925 |
| 79 | Ga0466728_140658 | 3300042620 | Bacteria | 3530 |
| 80 | Ga0466729_014086 | 3300042621 | Bacteria | 2184 |
| 81 | Ga0123356_10167693 | 3300010049 | Bacteria | 2202 |
| 82 | Ga0123353_11045346 | 3300010167 | Bacteria | 1091 |
| 83 | Ga0160464_100012 | 3300012805 | Bacteria | 297581 |
| 84 | Ga0160442_100027 | 3300012806 | Bacteria | 268121 |
| 85 | Ga0160468_100221 | 3300012819 | Bacteria | 33783 |
| 86 | Ga0160433_100032 | 3300012846 | Bacteria | 165473 |
| 87 | Ga0160433_100946 | 3300012846 | Bacteria | 9630 |
| 88 | Ga0415639_008492 | 3300038395 | Bacteria | 1335 |
| 89 | Ga0466656_037128 | 3300042550 | Bacteria | 2091 |
| 90 | Ga0466657_014755 | 3300042582 | Bacteria | 7108 |
| 91 | Ga0466691_038006 | 3300042593 | Bacteria | 38070 |
| 92 | Ga0466691_043419 | 3300042593 | Bacteria | 3271 |
| 93 | Ga0466691_101162 | 3300042593 | Bacteria | 30767 |
| 94 | Ga0466696_137349 | 3300042596 | Bacteria | 4678 |
| 95 | Ga0466696_423859 | 3300042596 | Bacteria | 4314 |
| 96 | JGI24702J35022_10001564 | 3300002462 | Bacteria | 14197 |
| 97 | Ga0103265_1000001 | 3300007068 | Bacteria | 182519 |
| 98 | Ga0102734_1000173 | 3300007129 | Bacteria | 30639 |
| 99 | Ga0104048_1003569 | 3300007143 | Bacteria | 3833 |
| 100 | Ga0466706_029899 | 3300042599 | Bacteria | 7567 |
| 101 | Ga0466707_009879 | 3300042601 | Bacteria | 8247 |
| 102 | Ga0466707_229818 | 3300042601 | Bacteria | 1788 |
| 103 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 104 | Ga0466713_110587 | 3300042602 | Bacteria | 23891 |
| 105 | Ga0466716_163195 | 3300042605 | Bacteria | 18133 |
| 106 | Ga0466703_094251 | 3300042636 | Bacteria | 4053 |
| 107 | Ga0466704_257211 | 3300042643 | Bacteria | 26069 |
| 108 | Ga0466704_372080 | 3300042643 | Bacteria | 34015 |
| 109 | Ga0466704_455163 | 3300042643 | Bacteria | 1302 |
| 110 | Ga0466724_18525 | 3300042649 | Bacteria | 22500 |
| 111 | Ga0466724_45886 | 3300042649 | Bacteria | 1698 |
| 112 | Ga0466708_149652 | 3300042652 | Bacteria | 14172 |
| 113 | Ga0466708_373242 | 3300042652 | Bacteria | 40600 |
| 114 | Ga0466705_022557 | 3300042612 | Bacteria | 35162 |
| 115 | Ga0466733_101824 | 3300042659 | Bacteria | 7911 |
| 116 | Ga0466710_239065 | 3300042613 | Bacteria | 2747 |
| 117 | Ga0466711_060561 | 3300042615 | Bacteria | 1461 |
| 118 | Ga0466711_166213 | 3300042615 | Bacteria | 8746 |
| 119 | Ga0466726_418393 | 3300042619 | Bacteria | 3169 |
| 120 | Ga0466728_205000 | 3300042620 | Bacteria | 11624 |
| 121 | Ga0466728_365599 | 3300042620 | Bacteria | 59795 |
| 122 | Ga0123356_10050020 | 3300010049 | Bacteria | 3891 |
| 123 | Ga0123353_10305644 | 3300010167 | Bacteria | 2424 |
| 124 | Ga0123353_11122764 | 3300010167 | Bacteria | 1041 |
| 125 | Ga0123354_10020755 | 3300010882 | Bacteria | 10339 |
| 126 | Ga0160457_1000023 | 3300012858 | Bacteria | 328177 |
| 127 | Ga0466690_309283 | 3300042590 | Bacteria | 99610 |
| 128 | Ga0466690_378780 | 3300042590 | Unclassified | 3355 |
| 129 | Ga0466694_061619 | 3300042594 | Bacteria | 1196 |
| 130 | Ga0466694_314395 | 3300042594 | Bacteria | 1658 |
| 131 | Ga0466696_447173 | 3300042596 | Bacteria | 8783 |
| 132 | IMNBL1DRAFT_c0002161 | 3300000062 | Bacteria | 13920 |
| 133 | JGI24699J35502_10987035 | 3300002509 | Bacteria | 1295 |
| 134 | Ga0104050_1017884 | 3300007153 | Bacteria | 1981 |
| 135 | Ga0466706_266524 | 3300042599 | Bacteria | 1580 |
| 136 | Ga0466700_059327 | 3300042600 | Bacteria | 11046 |
| 137 | Ga0466700_408110 | 3300042600 | Bacteria | 1393 |
| 138 | Ga0466707_031883 | 3300042601 | Bacteria | 8573 |
| 139 | Ga0466713_007771 | 3300042602 | Bacteria | 3104 |
| 140 | Ga0466713_054451 | 3300042602 | Bacteria | 168587 |
| 141 | Ga0466713_090398 | 3300042602 | Bacteria | 7566 |
| 142 | Ga0466714_125951 | 3300042603 | Bacteria | 7817 |
| 143 | Ga0466714_168924 | 3300042603 | Bacteria | 42928 |
| 144 | Ga0466716_160914 | 3300042605 | Bacteria | 1455 |
| 145 | Ga0466716_302877 | 3300042605 | Bacteria | 19456 |
| 146 | Ga0466719_512201 | 3300042606 | Bacteria | 4300 |
| 147 | Ga0466722_007565 | 3300042609 | Bacteria | 18233 |
| 148 | Ga0466722_181941 | 3300042609 | Bacteria | 4001 |
| 149 | Ga0466698_326523 | 3300042610 | Bacteria | 1741 |
| 150 | Ga0466698_432236 | 3300042610 | Bacteria | 2396 |
| 151 | Ga0466703_050395 | 3300042636 | Bacteria | 8463 |
| 152 | Ga0466703_401626 | 3300042636 | Bacteria | 5447 |
| 153 | Ga0466709_143689 | 3300042648 | Bacteria | 7856 |
| 154 | Ga0466727_013782 | 3300042655 | Bacteria | 8620 |
| 155 | Ga0466732_011800 | 3300042656 | Bacteria | 1304 |
| 156 | Ga0466733_054586 | 3300042659 | Bacteria | 2809 |
| 157 | Ga0466733_126074 | 3300042659 | Bacteria | 22337 |
| 158 | Ga0466715_182415 | 3300042616 | Bacteria | 13600 |
| 159 | Ga0123357_10040615 | 3300009784 | Bacteria | 6326 |
| 160 | Ga0123355_10360144 | 3300009826 | Bacteria | 1917 |
| 161 | Ga0466657_330578 | 3300042582 | Bacteria | 10823 |
| 162 | Ga0466691_150145 | 3300042593 | Bacteria | 10527 |
| 163 | Ga0466691_221741 | 3300042593 | Bacteria | 8925 |
| 164 | Ga0466696_080066 | 3300042596 | Bacteria | 3660 |
| 165 | IMNBL1DRAFT_c0022688 | 3300000062 | Bacteria | 2477 |
| 166 | JGI24702J35022_10217581 | 3300002462 | Bacteria | 1099 |
| 167 | Ga0103264_1000064 | 3300007188 | Bacteria | 124097 |
| 168 | Ga0466701_031730 | 3300042598 | Bacteria | 202867 |
| 169 | Ga0466706_214773 | 3300042599 | Bacteria | 3080 |
| 170 | Ga0466706_256850 | 3300042599 | Bacteria | 4851 |
| 171 | Ga0466707_334447 | 3300042601 | Bacteria | 2266 |
| 172 | Ga0466713_092950 | 3300042602 | Bacteria | 117604 |
| 173 | Ga0466717_020172 | 3300042604 | Bacteria | 4045 |
| 174 | Ga0466716_243725 | 3300042605 | Bacteria | 9928 |
| 175 | Ga0466719_116851 | 3300042606 | Bacteria | 4164 |
| 176 | Ga0466735_015214 | 3300042624 | Bacteria | 5642 |
| 177 | Ga0466735_079622 | 3300042624 | Bacteria | 3451 |
| 178 | Ga0466735_185014 | 3300042624 | Bacteria | 2474 |
| 179 | Ga0466730_100228 | 3300042625 | Bacteria | 3739 |
| 180 | Ga0466703_264243 | 3300042636 | Bacteria | 16326 |
| 181 | Ga0466703_402347 | 3300042636 | Bacteria | 2022 |
| 182 | Ga0466704_109371 | 3300042643 | Bacteria | 3042 |
| 183 | Ga0466704_119946 | 3300042643 | Bacteria | 27786 |
| 184 | Ga0466704_263814 | 3300042643 | Bacteria | 15948 |
| 185 | Ga0466704_270531 | 3300042643 | Bacteria | 5066 |
| 186 | Ga0466709_155512 | 3300042648 | Bacteria | 18975 |
| 187 | Ga0466708_258203 | 3300042652 | Bacteria | 4239 |
| 188 | Ga0466727_008903 | 3300042655 | Bacteria | 10438 |
| 189 | Ga0466733_064725 | 3300042659 | Bacteria | 6755 |
| 190 | Ga0466733_179381 | 3300042659 | Bacteria | 12874 |
| 191 | Ga0466711_398758 | 3300042615 | Bacteria | 47200 |
| 192 | Ga0466715_074729 | 3300042616 | Bacteria | 20866 |
| 193 | Ga0466715_208695 | 3300042616 | Bacteria | 2568 |
| 194 | Ga0466723_118562 | 3300042618 | Bacteria | 10951 |
| 195 | Ga0466726_255332 | 3300042619 | Bacteria | 3005 |
| 196 | Ga0123357_10014941 | 3300009784 | Bacteria | 10158 |
| 197 | Ga0123357_10042897 | 3300009784 | Bacteria | 6147 |
| 198 | Ga0123353_10718548 | 3300010167 | Bacteria | 1398 |
| 199 | Ga0160441_100187 | 3300012825 | Bacteria | 66188 |
| 200 | Ga0160472_100005 | 3300012839 | Bacteria | 734812 |
| 201 | Ga0466657_015317 | 3300042582 | Bacteria | 1241 |
| 202 | Ga0466690_123358 | 3300042590 | Bacteria | 18528 |
| 203 | Ga0466690_345522 | 3300042590 | Bacteria | 1171 |
| 204 | Ga0466692_030052 | 3300042591 | Bacteria | 80804 |
| 205 | Ga0466692_066856 | 3300042591 | Bacteria | 2129 |
| 206 | Ga0466692_087406 | 3300042591 | Bacteria | 30888 |
| 207 | Ga0466696_159475 | 3300042596 | Bacteria | 10201 |
| 208 | 2227552400 | 2225789004 | Unclassified | 14992 |
| 209 | IMNBL1DRAFT_c0000308 | 3300000062 | Bacteria | 41637 |
| 210 | JGI24702J35022_10000077 | 3300002462 | Bacteria | 43640 |
| 211 | JGI24702J35022_10009937 | 3300002462 | Bacteria | 5332 |
| 212 | JGI24699J35502_11058239 | 3300002509 | Bacteria | 1714 |
| 213 | Ga0068302_10199636 | 3300005071 | Bacteria | 1362 |
| 214 | Ga0102735_1001506 | 3300007080 | Bacteria | 6243 |
| 215 | Ga0466706_046752 | 3300042599 | Bacteria | 7867 |
| 216 | Ga0466706_088232 | 3300042599 | Bacteria | 3446 |
| 217 | Ga0466707_040792 | 3300042601 | Bacteria | 43826 |
| 218 | Ga0466707_179819 | 3300042601 | Bacteria | 23192 |
| 219 | Ga0466714_019102 | 3300042603 | Bacteria | 1602 |
| 220 | Ga0466719_361971 | 3300042606 | Bacteria | 8887 |
| 221 | Ga0466722_011881 | 3300042609 | Bacteria | 14700 |
| 222 | Ga0466722_034420 | 3300042609 | Bacteria | 1935 |
| 223 | Ga0466722_064987 | 3300042609 | Bacteria | 5448 |
| 224 | Ga0466722_109666 | 3300042609 | Bacteria | 1872 |
| 225 | Ga0466697_048910 | 3300042611 | Bacteria | 5672 |
| 226 | Ga0466729_234258 | 3300042621 | Bacteria | 6732 |
| 227 | Ga0466729_277451 | 3300042621 | Bacteria | 2948 |
| 228 | Ga0466735_068005 | 3300042624 | Bacteria | 5265 |
| 229 | Ga0466735_228167 | 3300042624 | Bacteria | 1333 |
| 230 | Ga0466704_112999 | 3300042643 | Bacteria | 5661 |
| 231 | Ga0466704_574095 | 3300042643 | Bacteria | 10040 |
| 232 | Ga0466708_137123 | 3300042652 | Bacteria | 9217 |
| 233 | Ga0466725_029985 | 3300042654 | Bacteria | 5336 |
| 234 | Ga0466727_302843 | 3300042655 | Bacteria | 2979 |
| 235 | Ga0466705_020560 | 3300042612 | Bacteria | 25648 |
| 236 | Ga0466733_041248 | 3300042659 | Bacteria | 6085 |
| 237 | Ga0466733_153210 | 3300042659 | Bacteria | 14068 |
| 238 | Ga0466710_141064 | 3300042613 | Bacteria | 7195 |
| 239 | Ga0466711_248557 | 3300042615 | Bacteria | 9307 |
| 240 | Ga0466715_014491 | 3300042616 | Bacteria | 10870 |
| 241 | Ga0466728_189559 | 3300042620 | Bacteria | 90681 |
| 242 | Ga0466728_291283 | 3300042620 | Bacteria | 12974 |
| 243 | Ga0466728_463614 | 3300042620 | Bacteria | 19348 |
| 244 | Ga0466729_194148 | 3300042621 | Bacteria | 5367 |
| 245 | Ga0123357_10005873 | 3300009784 | Bacteria | 14812 |
| 246 | Ga0123356_10308310 | 3300010049 | Bacteria | 1691 |
| 247 | Ga0123356_10410222 | 3300010049 | Bacteria | 1494 |
| 248 | Ga0123353_10885841 | 3300010167 | Bacteria | 1217 |
| 249 | Ga0160469_102374 | 3300012824 | Unclassified | 3568 |
| 250 | Ga0160431_106702 | 3300012828 | Bacteria | 1719 |
| 251 | Ga0160458_100020 | 3300012832 | Bacteria | 275525 |
| 252 | Ga0466690_402452 | 3300042590 | Unclassified | 5621 |
| 253 | Ga0466692_140391 | 3300042591 | Bacteria | 136970 |
| 254 | Ga0466691_199611 | 3300042593 | Bacteria | 1194 |
| 255 | Ga0466696_041535 | 3300042596 | Bacteria | 2826 |
| 256 | 2227094692 | 2225789004 | Bacteria | 9757 |
| 257 | IMNBL1DRAFT_c0006244 | 3300000062 | Bacteria | 6550 |
| 258 | Meta3P_1001625 | 3300002464 | Bacteria | 10161 |
| 259 | JGI24699J35502_11057902 | 3300002509 | Bacteria | 1711 |
| 260 | JGI24699J35502_11134224 | 3300002509 | Bacteria | 74083 |
| 261 | Ga0102740_1000062 | 3300007140 | Bacteria | 26226 |
| 262 | Ga0104048_1001194 | 3300007143 | Bacteria | 10033 |
| 263 | Ga0104050_1026589 | 3300007153 | Bacteria | 3270 |
| 264 | Ga0103267_1000837 | 3300007190 | Bacteria | 15988 |
| 265 | Ga0466701_025482 | 3300042598 | Bacteria | 168021 |
| 266 | Ga0466706_038099 | 3300042599 | Bacteria | 6247 |
| 267 | Ga0466706_068903 | 3300042599 | Bacteria | 60225 |
| 268 | Ga0466706_129933 | 3300042599 | Bacteria | 19122 |
| 269 | Ga0466713_012237 | 3300042602 | Bacteria | 8194 |
| 270 | Ga0466713_059747 | 3300042602 | Bacteria | 85224 |
| 271 | Ga0466735_041938 | 3300042624 | Bacteria | 1724 |
| 272 | Ga0466730_103185 | 3300042625 | Bacteria | 215676 |
| 273 | Ga0466703_287563 | 3300042636 | Bacteria | 16840 |
| 274 | Ga0466703_315201 | 3300042636 | Bacteria | 5627 |
| 275 | Ga0466704_029490 | 3300042643 | Bacteria | 6243 |
| 276 | Ga0466704_598609 | 3300042643 | Bacteria | 3672 |
| 277 | Ga0466709_258632 | 3300042648 | Bacteria | 10901 |
| 278 | Ga0466727_067627 | 3300042655 | Unclassified | 2523 |
| 279 | Ga0466727_151884 | 3300042655 | Bacteria | 54336 |
| 280 | Ga0466727_191470 | 3300042655 | Bacteria | 2657 |
| 281 | Ga0466727_206389 | 3300042655 | Bacteria | 26137 |
| 282 | Ga0466711_161163 | 3300042615 | Bacteria | 17839 |
| 283 | Ga0466723_033742 | 3300042618 | Bacteria | 108590 |
| 284 | Ga0466723_222366 | 3300042618 | Bacteria | 20836 |
| 285 | Ga0466726_009833 | 3300042619 | Bacteria | 3712 |
| 286 | Ga0466728_342097 | 3300042620 | Bacteria | 1064 |
| 287 | Ga0123357_10004948 | 3300009784 | Bacteria | 15815 |
| 288 | Ga0123357_10004974 | 3300009784 | Bacteria | 15783 |
| 289 | Ga0123353_10112816 | 3300010167 | Bacteria | 4376 |
| 290 | Ga0160460_100125 | 3300012845 | Bacteria | 96320 |
| 291 | Ga0264413_151565 | 3300024493 | Bacteria | 2972 |
| 292 | Ga0466657_177825 | 3300042582 | Bacteria | 1102 |
| 293 | Ga0466690_302558 | 3300042590 | Bacteria | 13388 |
| 294 | Ga0466693_025725 | 3300042592 | Bacteria | 2152 |
| 295 | 2227588489 | 2225789004 | Bacteria | 13141 |
| 296 | IMNBL1DRAFT_c0007110 | 3300000062 | Bacteria | 5956 |
| 297 | IMNBL1DRAFT_c0016330 | 3300000062 | Bacteria | 3183 |
| 298 | JGI24702J35022_10000272 | 3300002462 | Bacteria | 29833 |
| 299 | JGI24702J35022_10018196 | 3300002462 | Unclassified | 3832 |
| 300 | CVPL010W_10001408 | 3300002931 | Bacteria | 28235 |
| 301 | Ga0102736_1000288 | 3300007052 | Bacteria | 23183 |
| 302 | Ga0103268_1000294 | 3300007192 | Bacteria | 16203 |
| 303 | Ga0466706_034404 | 3300042599 | Bacteria | 32147 |
| 304 | Ga0466713_057198 | 3300042602 | Bacteria | 57543 |
| 305 | Ga0466713_139646 | 3300042602 | Bacteria | 516516 |
| 306 | Ga0466719_031598 | 3300042606 | Bacteria | 1760 |
| 307 | Ga0466719_317458 | 3300042606 | Bacteria | 1932 |
| 308 | Ga0466722_016895 | 3300042609 | Bacteria | 27981 |
| 309 | Ga0466735_079630 | 3300042624 | Bacteria | 2548 |
| 310 | Ga0466703_104616 | 3300042636 | Bacteria | 4234 |
| 311 | Ga0466703_226835 | 3300042636 | Bacteria | 9267 |
| 312 | Ga0466709_215380 | 3300042648 | Bacteria | 33059 |
| 313 | Ga0466709_321709 | 3300042648 | Bacteria | 6740 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02548 | Pantoate_transf | Ketopantoate hydroxymethyltransferase | 76 | 334 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.