Protein Family IF09141
Metagenome
Isolate
190
Members
91
Samples
143
Scaffolds
404.85
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_102108|Ga0466703_102108_9620_10957
- Length
- 445 aa
- Sequence
- MPPCGELGRLPMYIIPASGAFFNGFPNTLTVIIRRARAMAKEKIVLAYSGGLDTSIIIPWLKENYGYEVIAMAADVGQGEELSPLREKAIKTGASKIYIEDLKDEFVRDFIFPTLKAGAMYEGKYLLGTSFARPLIAKRLVEIARQEGAAAIAHGATGKGNDQVRFELTVKALAPELRIIAPWRIWDIRSRDDEIAYAEARGIPLQTKKADSYSMDRNIWHLSHEGLELEDPANEPNYGRMLQMITPPEAAPDKPAYAVLRFEKGVPVELNGEAMQPVPLLEELNEIAGRNGVGILDMVENRLVGMKSRGVYETPGGSVLYAAHRELEYLCLDRETLHYKDLVAQKFAELVYYGQWYTPLREALSAFVDSTQANVSGVARLKLYKGLVSPAGSTSEFSLYSEELSTFARDEVYNQKDAEGFINLFGLPMKVEALMKQRGGRAAGA
Sample Types
Isolate
24.7%
Metagenome
75.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
27.8%
Termitidae
25.6%
Blattidae
21.1%
Kalotermitidae
15.6%
Rhinotermitidae
2.2%
Passalidae
2.2%
Termopsidae
2.2%
Hodotermitidae
1.1%
Tenebrionidae
1.1%
Scarabaeidae
1.1%
Taxonomy
Archaea
5
Bacteria
177
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 2 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 3 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 4 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 5 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 6 | 2820038073 | Unclassified Saccharibacteria Lab288P4bin92 | Isolate | Unclassified |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 18 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 19 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 20 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 21 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 22 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 23 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 24 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 25 | 2820032565 | Unclassified Saccharibacteria Th196P3bin19 | Isolate | Unclassified |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 28 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 32 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 35 | 2773857692 | Unclassified Methanomassiliicoccaceae Th196P3bin2 | Isolate | Unclassified |
| 36 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 37 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 38 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 39 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 44 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 45 | 2773857688 | Unclassified Methanomassiliicoccaceae Nt197P3bin45 | Isolate | Unclassified |
| 46 | 2820580397 | Unclassified Firmicutes Emb289P3bin133 | Isolate | Unclassified |
| 47 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 48 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 52 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 53 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 54 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 55 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 56 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 57 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 58 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 61 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 62 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 63 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 64 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 65 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 66 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 67 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 68 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 69 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 70 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 71 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 72 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 73 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 74 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 75 | 2773857696 | Unclassified Methanomassiliicoccaceae Th196P4bin4 | Isolate | Unclassified |
| 76 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 77 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 78 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 79 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 80 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 81 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 82 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 83 | 2773857686 | Unclassified Methanomassiliicoccaceae Lab288P4bin70 | Isolate | Unclassified |
| 84 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 85 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 86 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 87 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 88 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 89 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 90 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 91 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_027434 | 3300042599 | Bacteria | 31984 |
| 2 | Ga0466706_061569 | 3300042599 | Bacteria | 11465 |
| 3 | Ga0466713_074945 | 3300042602 | Bacteria | 26421 |
| 4 | Ga0466722_268633 | 3300042609 | Bacteria | 2280 |
| 5 | Ga0466656_312747 | 3300042550 | Bacteria | 7232 |
| 6 | Ga0466705_098255 | 3300042612 | Bacteria | 6249 |
| 7 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 8 | Ga0466702_006979 | 3300042635 | Bacteria | 11791 |
| 9 | Ga0466703_050296 | 3300042636 | Bacteria | 1858 |
| 10 | Ga0466704_532443 | 3300042643 | Bacteria | 2533 |
| 11 | 2227494069 | 2225789004 | Unclassified | 20288 |
| 12 | IMNBL1DRAFT_c0000024 | 3300000062 | Bacteria | 141336 |
| 13 | Ga0072940_1014304 | 3300005200 | Bacteria | 1732 |
| 14 | Ga0123353_10026490 | 3300010167 | Bacteria | 8858 |
| 15 | Ga0123353_10083196 | 3300010167 | Bacteria | 5149 |
| 16 | Ga0123353_10661363 | 3300010167 | Bacteria | 1476 |
| 17 | Ga0466729_019512 | 3300042621 | Bacteria | 20610 |
| 18 | Ga0466706_036062 | 3300042599 | Unclassified | 5622 |
| 19 | Ga0466706_049182 | 3300042599 | Bacteria | 4566 |
| 20 | Ga0466706_106899 | 3300042599 | Bacteria | 69614 |
| 21 | Ga0466707_106253 | 3300042601 | Bacteria | 108878 |
| 22 | Ga0466707_297130 | 3300042601 | Bacteria | 8935 |
| 23 | Ga0466714_071268 | 3300042603 | Bacteria | 6197 |
| 24 | Ga0466719_506913 | 3300042606 | Bacteria | 2664 |
| 25 | Ga0466722_198787 | 3300042609 | Bacteria | 2205 |
| 26 | Ga0466696_099882 | 3300042596 | Bacteria | 22150 |
| 27 | Ga0466704_514477 | 3300042643 | Unclassified | 2875 |
| 28 | Ga0466727_312587 | 3300042655 | Bacteria | 5689 |
| 29 | Ga0123355_10000077 | 3300009826 | Bacteria | 104090 |
| 30 | Ga0123354_10002007 | 3300010882 | Bacteria | 26158 |
| 31 | Ga0466715_411615 | 3300042616 | Bacteria | 12165 |
| 32 | Ga0466723_080509 | 3300042618 | Bacteria | 4066 |
| 33 | Ga0466713_142802 | 3300042602 | Bacteria | 224732 |
| 34 | Ga0466722_080725 | 3300042609 | Bacteria | 12286 |
| 35 | Ga0466722_089627 | 3300042609 | Bacteria | 6382 |
| 36 | Ga0466722_147052 | 3300042609 | Bacteria | 82065 |
| 37 | Ga0415639_088387 | 3300038395 | Bacteria | 2121 |
| 38 | Ga0466657_339503 | 3300042582 | Archaea | 1958 |
| 39 | Ga0466691_190317 | 3300042593 | Bacteria | 5163 |
| 40 | Ga0466696_066776 | 3300042596 | Bacteria | 100039 |
| 41 | Ga0466696_429244 | 3300042596 | Bacteria | 6955 |
| 42 | Ga0466702_338815 | 3300042635 | Bacteria | 1741 |
| 43 | Ga0466703_139122 | 3300042636 | Bacteria | 1411 |
| 44 | Ga0466704_288417 | 3300042643 | Bacteria | 52572 |
| 45 | Ga0466709_060631 | 3300042648 | Bacteria | 4116 |
| 46 | IMNBL1DRAFT_c0003761 | 3300000062 | Bacteria | 9493 |
| 47 | IMNBL1DRAFT_c0013345 | 3300000062 | Bacteria | 3692 |
| 48 | Ga0072940_1123098 | 3300005200 | Unclassified | 4135 |
| 49 | Ga0123355_10097927 | 3300009826 | Bacteria | 4627 |
| 50 | Ga0123353_10401382 | 3300010167 | Bacteria | 2040 |
| 51 | Ga0466729_157447 | 3300042621 | Bacteria | 1575 |
| 52 | Ga0466706_133976 | 3300042599 | Bacteria | 1395 |
| 53 | Ga0466713_036717 | 3300042602 | Bacteria | 63148 |
| 54 | Ga0466657_033351 | 3300042582 | Bacteria | 8095 |
| 55 | Ga0466693_163184 | 3300042592 | Bacteria | 2538 |
| 56 | Ga0466703_406272 | 3300042636 | Bacteria | 4449 |
| 57 | Ga0466709_053322 | 3300042648 | Bacteria | 44724 |
| 58 | Ga0466708_052469 | 3300042652 | Bacteria | 21078 |
| 59 | IMNBL1DRAFT_c0000042 | 3300000062 | Bacteria | 116840 |
| 60 | IMNBL1DRAFT_c0007322 | 3300000062 | Bacteria | 5834 |
| 61 | Ga0466715_056947 | 3300042616 | Bacteria | 13060 |
| 62 | Ga0466723_055905 | 3300042618 | Bacteria | 5650 |
| 63 | Ga0466723_317389 | 3300042618 | Bacteria | 4527 |
| 64 | Ga0466728_465799 | 3300042620 | Bacteria | 2338 |
| 65 | Ga0466728_470341 | 3300042620 | Bacteria | 2671 |
| 66 | Ga0466706_097167 | 3300042599 | Bacteria | 10374 |
| 67 | Ga0466706_133896 | 3300042599 | Bacteria | 3596 |
| 68 | Ga0466706_223825 | 3300042599 | Bacteria | 13439 |
| 69 | Ga0466706_262563 | 3300042599 | Bacteria | 1678 |
| 70 | Ga0466705_077511 | 3300042612 | Bacteria | 1698 |
| 71 | Ga0466705_282480 | 3300042612 | Bacteria | 27901 |
| 72 | Ga0466733_064792 | 3300042659 | Bacteria | 3475 |
| 73 | Ga0466704_085361 | 3300042643 | Bacteria | 4795 |
| 74 | Ga0466708_059982 | 3300042652 | Bacteria | 11847 |
| 75 | 2227535725 | 2225789004 | Bacteria | 57920 |
| 76 | IMNBL1DRAFT_c0005294 | 3300000062 | Bacteria | 7429 |
| 77 | JGI24695J34938_10005003 | 3300002450 | Bacteria | 8438 |
| 78 | JGI24702J35022_10000080 | 3300002462 | Bacteria | 42310 |
| 79 | JGI24705J35276_12235198 | 3300002504 | Bacteria | 6291 |
| 80 | Ga0123357_10019891 | 3300009784 | Bacteria | 8963 |
| 81 | Ga0123357_10056294 | 3300009784 | Bacteria | 5289 |
| 82 | Ga0123356_10053311 | 3300010049 | Bacteria | 3764 |
| 83 | Ga0466711_405101 | 3300042615 | Bacteria | 2405 |
| 84 | Ga0466715_434980 | 3300042616 | Bacteria | 12784 |
| 85 | Ga0466715_487687 | 3300042616 | Bacteria | 20052 |
| 86 | Ga0466718_139653 | 3300042617 | Bacteria | 1628 |
| 87 | Ga0466726_074482 | 3300042619 | Bacteria | 4445 |
| 88 | Ga0466726_299064 | 3300042619 | Bacteria | 2097 |
| 89 | Ga0466706_253456 | 3300042599 | Bacteria | 6715 |
| 90 | Ga0466707_061531 | 3300042601 | Bacteria | 4538 |
| 91 | Ga0466713_076869 | 3300042602 | Bacteria | 66298 |
| 92 | Ga0466657_048199 | 3300042582 | Bacteria | 2057 |
| 93 | Ga0466690_047239 | 3300042590 | Bacteria | 1324 |
| 94 | Ga0466690_098387 | 3300042590 | Bacteria | 130488 |
| 95 | Ga0466690_141135 | 3300042590 | Bacteria | 30489 |
| 96 | Ga0466705_134690 | 3300042612 | Bacteria | 3474 |
| 97 | Ga0466705_186205 | 3300042612 | Bacteria | 6655 |
| 98 | Ga0466705_194741 | 3300042612 | Unclassified | 6595 |
| 99 | Ga0466703_102108 | 3300042636 | Bacteria | 11983 |
| 100 | IMNBL1DRAFT_c0007209 | 3300000062 | Bacteria | 5896 |
| 101 | Ga0074263_118831 | 3300005485 | Bacteria | 3499 |
| 102 | Ga0123355_10151865 | 3300009826 | Bacteria | 3516 |
| 103 | Ga0123353_10216090 | 3300010167 | Bacteria | 3003 |
| 104 | Ga0466710_210512 | 3300042613 | Bacteria | 2085 |
| 105 | Ga0466711_386053 | 3300042615 | Bacteria | 1843 |
| 106 | Ga0466715_361731 | 3300042616 | Bacteria | 1991 |
| 107 | Ga0466715_367868 | 3300042616 | Bacteria | 44460 |
| 108 | Ga0466715_492110 | 3300042616 | Bacteria | 4017 |
| 109 | Ga0466718_101734 | 3300042617 | Unclassified | 5483 |
| 110 | Ga0466706_266740 | 3300042599 | Bacteria | 1974 |
| 111 | Ga0466713_054546 | 3300042602 | Bacteria | 6831 |
| 112 | Ga0466713_090642 | 3300042602 | Bacteria | 74862 |
| 113 | Ga0466719_411668 | 3300042606 | Bacteria | 6040 |
| 114 | Ga0466719_453242 | 3300042606 | Bacteria | 34649 |
| 115 | Ga0466722_007019 | 3300042609 | Bacteria | 2999 |
| 116 | Ga0415639_099321 | 3300038395 | Unclassified | 2568 |
| 117 | Ga0466705_027933 | 3300042612 | Bacteria | 34695 |
| 118 | Ga0466705_362917 | 3300042612 | Bacteria | 9301 |
| 119 | Ga0466733_219400 | 3300042659 | Bacteria | 1491 |
| 120 | Ga0466709_195058 | 3300042648 | Bacteria | 51317 |
| 121 | Ga0466724_06847 | 3300042649 | Bacteria | 1377 |
| 122 | JGI24705J35276_12237447 | 3300002504 | Bacteria | 11159 |
| 123 | Ga0123353_10008403 | 3300010167 | Unclassified | 14090 |
| 124 | Ga0123353_10009673 | 3300010167 | Bacteria | 13349 |
| 125 | Ga0123353_10040004 | 3300010167 | Bacteria | 7390 |
| 126 | Ga0123353_10153715 | 3300010167 | Bacteria | 3671 |
| 127 | Ga0466715_179055 | 3300042616 | Bacteria | 62432 |
| 128 | Ga0466729_054618 | 3300042621 | Bacteria | 7909 |
| 129 | Ga0466729_135173 | 3300042621 | Bacteria | 102359 |
| 130 | Ga0466706_003350 | 3300042599 | Bacteria | 4219 |
| 131 | Ga0466706_088240 | 3300042599 | Bacteria | 11045 |
| 132 | Ga0466706_112528 | 3300042599 | Bacteria | 11757 |
| 133 | Ga0466706_175842 | 3300042599 | Bacteria | 9622 |
| 134 | Ga0466706_254562 | 3300042599 | Bacteria | 3616 |
| 135 | Ga0466690_406316 | 3300042590 | Bacteria | 1437 |
| 136 | Ga0466733_026865 | 3300042659 | Bacteria | 2795 |
| 137 | Ga0466702_151628 | 3300042635 | Bacteria | 1410 |
| 138 | 2227507950 | 2225789004 | Bacteria | 69912 |
| 139 | Ga0072941_1056044 | 3300005201 | Bacteria | 27875 |
| 140 | Ga0123356_10063014 | 3300010049 | Bacteria | 3464 |
| 141 | Ga0123353_10366723 | 3300010167 | Bacteria | 2161 |
| 142 | Ga0466715_025645 | 3300042616 | Bacteria | 15355 |
| 143 | Ga0466726_053094 | 3300042619 | Bacteria | 1875 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.