Protein Family IF09060
Metagenome
Isolate
402
Members
105
Samples
358
Scaffolds
181.3
Avg Length
Representative Sequence
- ID
- 3300042635|Ga0466702_244037|Ga0466702_244037_692_1339
- Length
- 215 aa
- Sequence
- LKNWGKVGYFKNRHCQQPYPALYYFHKDQLKTKERKMKKWVCSVCGYVHTGDQPPAQCPQCKVPAEKFKEQKADGGYAAEHVVGVAKGVDADIIKDLQAHFNGECCEVGMYLAMSRVAEREGYPEIADAYKRYAFEEAEHAAKFAELLGEVITDSTKKNLELRIEAEFGACAGKMDIAKRAKAKDLDAIHDTVHEMARDEARHCAGFKGLLKRYF
Sample Types
Isolate
10.7%
Metagenome
89.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
34.6%
Termitidae
34.6%
Kalotermitidae
12.5%
Blattidae
5.8%
Termopsidae
3.8%
Rhinotermitidae
3.8%
Passalidae
2.9%
Tenebrionidae
1.0%
Hodotermitidae
1.0%
Taxonomy
Archaea
3
Bacteria
330
Eukaryota
0
Viruses
0
Unclassified
69
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 2 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 3 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 4 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 5 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 6 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 7 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 8 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 9 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 10 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 11 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 12 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 13 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 16 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 17 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 18 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 21 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 22 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 23 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 33 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 34 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 35 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 36 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 37 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 42 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 43 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 44 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 45 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 46 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 47 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 48 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 52 | 2772190995 | Unclassified Bathyarchaeota Lab288P3bin115 | Isolate | Unclassified |
| 53 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 54 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 55 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 56 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 57 | 2820707375 | Unclassified Firmicutes Co191P1bin31 | Isolate | Unclassified |
| 58 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 59 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 60 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 61 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 62 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 63 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 64 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 65 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 66 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 67 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 68 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 69 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 70 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 71 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 72 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 73 | 2772190996 | Unclassified Bathyarchaeota Lab288P4bin61 | Isolate | Unclassified |
| 74 | 2772190997 | Unclassified Bathyarchaeota Lab288P4bin25 | Isolate | Unclassified |
| 75 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 76 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 77 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 78 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 79 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 80 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 81 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 82 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 83 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 84 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 85 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 86 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 87 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 88 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 89 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 90 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 91 | 2820285501 | Unclassified Firmicutes Th196P3bin142 | Isolate | Unclassified |
| 92 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 93 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 94 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 95 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 96 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 97 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 98 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 99 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 100 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 101 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 102 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 103 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 104 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 105 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_116175 | 3300042611 | Bacteria | 1730 |
| 2 | Ga0456237_0002380 | 3300041968 | Bacteria | 3041 |
| 3 | Ga0466693_442817 | 3300042592 | Bacteria | 1306 |
| 4 | Ga0466696_398243 | 3300042596 | Bacteria | 5426 |
| 5 | Ga0466699_047240 | 3300042597 | Bacteria | 17629 |
| 6 | Ga0466699_211134 | 3300042597 | Unclassified | 1713 |
| 7 | Ga0466699_255660 | 3300042597 | Bacteria | 9779 |
| 8 | Ga0466699_274424 | 3300042597 | Unclassified | 2103 |
| 9 | Ga0466712_029677 | 3300042614 | Bacteria | 1153 |
| 10 | Ga0466712_049264 | 3300042614 | Bacteria | 9851 |
| 11 | Ga0466712_284916 | 3300042614 | Bacteria | 2599 |
| 12 | Ga0466712_315083 | 3300042614 | Bacteria | 10061 |
| 13 | Ga0466726_118876 | 3300042619 | Bacteria | 2173 |
| 14 | Ga0123355_10129114 | 3300009826 | Bacteria | 3898 |
| 15 | Ga0123355_10793728 | 3300009826 | Bacteria | 1058 |
| 16 | Ga0123356_10010554 | 3300010049 | Bacteria | 9054 |
| 17 | Ga0123356_10108625 | 3300010049 | Bacteria | 2675 |
| 18 | Ga0123353_11832944 | 3300010167 | Bacteria | 752 |
| 19 | Ga0466706_092045 | 3300042599 | Bacteria | 8250 |
| 20 | Ga0466706_150038 | 3300042599 | Bacteria | 1760 |
| 21 | Ga0466707_297702 | 3300042601 | Bacteria | 2529 |
| 22 | Ga0466717_296668 | 3300042604 | Unclassified | 9098 |
| 23 | Ga0466720_063370 | 3300042607 | Bacteria | 22238 |
| 24 | Ga0466721_159528 | 3300042608 | Bacteria | 40005 |
| 25 | Ga0466722_057243 | 3300042609 | Bacteria | 19185 |
| 26 | Ga0466722_071943 | 3300042609 | Unclassified | 1237 |
| 27 | Ga0466722_219495 | 3300042609 | Bacteria | 1819 |
| 28 | Ga0466722_221080 | 3300042609 | Unclassified | 1080 |
| 29 | Ga0466698_281095 | 3300042610 | Unclassified | 1194 |
| 30 | Ga0466697_055019 | 3300042611 | Unclassified | 1659 |
| 31 | IMNBL1DRAFT_c0002974 | 3300000062 | Bacteria | 11257 |
| 32 | AustNasuHG_c1000799 | 3300000089 | Bacteria | 11285 |
| 33 | JGI24698J34947_10010127 | 3300002449 | Bacteria | 5166 |
| 34 | JGI24698J34947_10016812 | 3300002449 | Bacteria | 3969 |
| 35 | JGI24698J34947_10017103 | 3300002449 | Bacteria | 3934 |
| 36 | JGI24698J34947_10019482 | 3300002449 | Unclassified | 3659 |
| 37 | JGI24698J34947_10020911 | 3300002449 | Bacteria | 3523 |
| 38 | JGI24698J34947_10029364 | 3300002449 | Unclassified | 2904 |
| 39 | JGI24698J34947_10031992 | 3300002449 | Bacteria | 2765 |
| 40 | JGI24698J34947_10048032 | 3300002449 | Unclassified | 2163 |
| 41 | JGI24698J34947_10081688 | 3300002449 | Unclassified | 1514 |
| 42 | JGI24695J34938_10000190 | 3300002450 | Bacteria | 57427 |
| 43 | JGI24702J35022_10393262 | 3300002462 | Bacteria | 836 |
| 44 | Ga0068302_10208220 | 3300005071 | Bacteria | 2466 |
| 45 | Ga0466731_365705 | 3300042622 | Bacteria | 1893 |
| 46 | Ga0466735_130334 | 3300042624 | Unclassified | 4445 |
| 47 | Ga0466702_463476 | 3300042635 | Bacteria | 1424 |
| 48 | Ga0466704_369273 | 3300042643 | Bacteria | 2076 |
| 49 | Ga0466725_063965 | 3300042654 | Bacteria | 1199 |
| 50 | Ga0466727_290971 | 3300042655 | Bacteria | 2135 |
| 51 | Ga0466732_308009 | 3300042656 | Bacteria | 4183 |
| 52 | Ga0466692_110884 | 3300042591 | Bacteria | 1430 |
| 53 | Ga0466692_185606 | 3300042591 | Unclassified | 2733 |
| 54 | Ga0466694_340806 | 3300042594 | Bacteria | 14731 |
| 55 | Ga0466699_016070 | 3300042597 | Unclassified | 1221 |
| 56 | Ga0466699_126006 | 3300042597 | Bacteria | 2927 |
| 57 | Ga0466699_147278 | 3300042597 | Bacteria | 14003 |
| 58 | Ga0466712_121834 | 3300042614 | Unclassified | 2577 |
| 59 | Ga0466712_133105 | 3300042614 | Bacteria | 1308 |
| 60 | Ga0466712_147596 | 3300042614 | Bacteria | 5203 |
| 61 | Ga0466718_048152 | 3300042617 | Bacteria | 1212 |
| 62 | Ga0466723_248271 | 3300042618 | Bacteria | 7600 |
| 63 | Ga0466729_000473 | 3300042621 | Bacteria | 3646 |
| 64 | Ga0123357_10220617 | 3300009784 | Bacteria | 2104 |
| 65 | Ga0123355_10305438 | 3300009826 | Bacteria | 2163 |
| 66 | Ga0123356_10017754 | 3300010049 | Bacteria | 6761 |
| 67 | Ga0123356_10153198 | 3300010049 | Bacteria | 2292 |
| 68 | Ga0123356_10171190 | 3300010049 | Bacteria | 2182 |
| 69 | Ga0123356_10558166 | 3300010049 | Bacteria | 1307 |
| 70 | Ga0123356_10789973 | 3300010049 | Bacteria | 1120 |
| 71 | Ga0123356_11092962 | 3300010049 | Bacteria | 966 |
| 72 | Ga0123356_11449559 | 3300010049 | Bacteria | 846 |
| 73 | Ga0123356_12328761 | 3300010049 | Bacteria | 670 |
| 74 | Ga0123353_10144121 | 3300010167 | Bacteria | 3811 |
| 75 | Ga0123353_10297011 | 3300010167 | Bacteria | 2469 |
| 76 | Ga0123353_10760305 | 3300010167 | Unclassified | 1347 |
| 77 | Ga0123353_11177546 | 3300010167 | Bacteria | 1008 |
| 78 | Ga0466700_486793 | 3300042600 | Unclassified | 1064 |
| 79 | Ga0466707_393543 | 3300042601 | Bacteria | 1036 |
| 80 | Ga0466713_032690 | 3300042602 | Bacteria | 1342 |
| 81 | Ga0466720_062328 | 3300042607 | Bacteria | 37859 |
| 82 | Ga0466722_081790 | 3300042609 | Bacteria | 5653 |
| 83 | Ga0466698_398215 | 3300042610 | Bacteria | 8567 |
| 84 | IMNBL1DRAFT_c0000430 | 3300000062 | Bacteria | 35267 |
| 85 | JGI24698J34947_10003404 | 3300002449 | Bacteria | 8634 |
| 86 | JGI24698J34947_10132148 | 3300002449 | Unclassified | 1065 |
| 87 | JGI24695J34938_10014263 | 3300002450 | Bacteria | 4129 |
| 88 | JGI24702J35022_10003062 | 3300002462 | Bacteria | 10108 |
| 89 | JGI24702J35022_10040904 | 3300002462 | Bacteria | 2472 |
| 90 | JGI24702J35022_10052974 | 3300002462 | Bacteria | 2163 |
| 91 | Ga0068305_10031172 | 3300005083 | Unclassified | 5736 |
| 92 | Ga0068305_10251960 | 3300005083 | Bacteria | 4541 |
| 93 | Ga0466702_061677 | 3300042635 | Bacteria | 3096 |
| 94 | Ga0466702_171137 | 3300042635 | Unclassified | 1778 |
| 95 | Ga0466704_012307 | 3300042643 | Bacteria | 6703 |
| 96 | Ga0466704_408985 | 3300042643 | Bacteria | 1564 |
| 97 | Ga0466705_214624 | 3300042612 | Bacteria | 141704 |
| 98 | Ga0466732_172699 | 3300042656 | Bacteria | 5185 |
| 99 | Ga0466733_110568 | 3300042659 | Bacteria | 2397 |
| 100 | Ga0415639_030310 | 3300038395 | Bacteria | 4754 |
| 101 | Ga0415639_083668 | 3300038395 | Bacteria | 2328 |
| 102 | Ga0466693_387266 | 3300042592 | Bacteria | 6033 |
| 103 | Ga0466694_023621 | 3300042594 | Bacteria | 46663 |
| 104 | Ga0466694_175976 | 3300042594 | Bacteria | 4652 |
| 105 | Ga0466699_095937 | 3300042597 | Unclassified | 1838 |
| 106 | Ga0466712_122936 | 3300042614 | Bacteria | 1438 |
| 107 | Ga0466712_169604 | 3300042614 | Bacteria | 3879 |
| 108 | Ga0466711_132671 | 3300042615 | Bacteria | 2305 |
| 109 | Ga0123356_10058255 | 3300010049 | Unclassified | 3601 |
| 110 | Ga0123353_10002912 | 3300010167 | Bacteria | 21424 |
| 111 | Ga0123353_10580527 | 3300010167 | Bacteria | 1608 |
| 112 | Ga0123353_11001066 | 3300010167 | Unclassified | 1123 |
| 113 | Ga0123354_10059659 | 3300010882 | Bacteria | 5655 |
| 114 | Ga0466706_087852 | 3300042599 | Bacteria | 4143 |
| 115 | Ga0466706_230351 | 3300042599 | Bacteria | 7228 |
| 116 | Ga0466700_145243 | 3300042600 | Bacteria | 1488 |
| 117 | Ga0466713_120506 | 3300042602 | Bacteria | 2488 |
| 118 | Ga0466717_024648 | 3300042604 | Bacteria | 1065 |
| 119 | Ga0466716_242552 | 3300042605 | Bacteria | 13235 |
| 120 | Ga0466721_065190 | 3300042608 | Bacteria | 1106 |
| 121 | Ga0466722_030733 | 3300042609 | Unclassified | 7251 |
| 122 | IMNBL1DRAFT_c0013920 | 3300000062 | Bacteria | 3579 |
| 123 | JGI24698J34947_10005845 | 3300002449 | Bacteria | 6743 |
| 124 | JGI24698J34947_10085382 | 3300002449 | Unclassified | 1466 |
| 125 | JGI24698J34947_10118637 | 3300002449 | Unclassified | 1153 |
| 126 | JGI24698J34947_10195104 | 3300002449 | Unclassified | 798 |
| 127 | JGI24695J34938_10018333 | 3300002450 | Bacteria | 3504 |
| 128 | JGI24695J34938_10041426 | 3300002450 | Bacteria | 2068 |
| 129 | JGI24695J34938_10087864 | 3300002450 | Bacteria | 1278 |
| 130 | JGI24702J35022_10002991 | 3300002462 | Bacteria | 10230 |
| 131 | JGI24702J35022_10014939 | 3300002462 | Bacteria | 4278 |
| 132 | JGI24702J35022_10137666 | 3300002462 | Bacteria | 1360 |
| 133 | JGI24705J35276_12238585 | 3300002504 | Unclassified | 27620 |
| 134 | Ga0466734_014785 | 3300042623 | Bacteria | 1404 |
| 135 | Ga0466702_244037 | 3300042635 | Bacteria | 1911 |
| 136 | Ga0466703_204685 | 3300042636 | Bacteria | 11244 |
| 137 | Ga0466697_171077 | 3300042611 | Unclassified | 5296 |
| 138 | Ga0466697_262836 | 3300042611 | Unclassified | 2989 |
| 139 | Ga0466733_025888 | 3300042659 | Bacteria | 28930 |
| 140 | Ga0466692_080306 | 3300042591 | Bacteria | 1699 |
| 141 | Ga0466694_184925 | 3300042594 | Bacteria | 1577 |
| 142 | Ga0466699_008263 | 3300042597 | Bacteria | 1597 |
| 143 | Ga0466699_288739 | 3300042597 | Unclassified | 1745 |
| 144 | Ga0466705_504301 | 3300042612 | Bacteria | 7180 |
| 145 | Ga0466712_071488 | 3300042614 | Unclassified | 2063 |
| 146 | Ga0466712_113166 | 3300042614 | Unclassified | 2842 |
| 147 | Ga0466726_394495 | 3300042619 | Bacteria | 1579 |
| 148 | Ga0466728_121810 | 3300042620 | Bacteria | 39038 |
| 149 | Ga0123357_10239032 | 3300009784 | Bacteria | 1971 |
| 150 | Ga0123355_10075523 | 3300009826 | Bacteria | 5393 |
| 151 | Ga0123355_10158504 | 3300009826 | Bacteria | 3417 |
| 152 | Ga0123355_10769387 | 3300009826 | Bacteria | 1083 |
| 153 | Ga0123356_10009610 | 3300010049 | Unclassified | 9541 |
| 154 | Ga0123356_10052656 | 3300010049 | Bacteria | 3787 |
| 155 | Ga0123356_10079882 | 3300010049 | Bacteria | 3091 |
| 156 | Ga0123356_10766212 | 3300010049 | Unclassified | 1135 |
| 157 | Ga0123356_11833578 | 3300010049 | Bacteria | 754 |
| 158 | Ga0123353_10003257 | 3300010167 | Bacteria | 20481 |
| 159 | Ga0123353_10008762 | 3300010167 | Unclassified | 13858 |
| 160 | Ga0123353_10262038 | 3300010167 | Bacteria | 2669 |
| 161 | Ga0123353_10610478 | 3300010167 | Bacteria | 1556 |
| 162 | Ga0123353_10753969 | 3300010167 | Bacteria | 1354 |
| 163 | Ga0123353_10793232 | 3300010167 | Bacteria | 1309 |
| 164 | Ga0123354_10652444 | 3300010882 | Unclassified | 751 |
| 165 | Ga0466706_047848 | 3300042599 | Bacteria | 18796 |
| 166 | Ga0466700_326139 | 3300042600 | Bacteria | 1892 |
| 167 | Ga0466707_421942 | 3300042601 | Unclassified | 7377 |
| 168 | Ga0466713_006243 | 3300042602 | Bacteria | 73153 |
| 169 | Ga0466722_170031 | 3300042609 | Bacteria | 1445 |
| 170 | Ga0466698_228318 | 3300042610 | Bacteria | 1769 |
| 171 | Ga0466698_323290 | 3300042610 | Bacteria | 2471 |
| 172 | 2227191902 | 2225789004 | Bacteria | 34507 |
| 173 | AustNasuHG_c1008780 | 3300000089 | Unclassified | 3574 |
| 174 | JGI24698J34947_10016554 | 3300002449 | Bacteria | 3999 |
| 175 | JGI24695J34938_10000094 | 3300002450 | Bacteria | 78292 |
| 176 | JGI24702J35022_10082247 | 3300002462 | Bacteria | 1745 |
| 177 | JGI24705J35276_12218091 | 3300002504 | Unclassified | 2127 |
| 178 | JGI24705J35276_12233958 | 3300002504 | Bacteria | 5163 |
| 179 | Ga0074263_109604 | 3300005485 | Unclassified | 2436 |
| 180 | Ga0466731_097605 | 3300042622 | Bacteria | 1325 |
| 181 | Ga0466735_062685 | 3300042624 | Bacteria | 1082 |
| 182 | Ga0466702_009767 | 3300042635 | Bacteria | 13733 |
| 183 | Ga0466724_20619 | 3300042649 | Bacteria | 1199 |
| 184 | Ga0466724_34410 | 3300042649 | Bacteria | 3602 |
| 185 | Ga0466727_289814 | 3300042655 | Bacteria | 1062 |
| 186 | Ga0466705_137413 | 3300042612 | Bacteria | 3481 |
| 187 | Ga0466692_182145 | 3300042591 | Bacteria | 1480 |
| 188 | Ga0466691_120877 | 3300042593 | Bacteria | 4175 |
| 189 | Ga0466699_087342 | 3300042597 | Bacteria | 2737 |
| 190 | Ga0466699_189752 | 3300042597 | Bacteria | 9395 |
| 191 | Ga0466710_301687 | 3300042613 | Unclassified | 2801 |
| 192 | Ga0466718_066446 | 3300042617 | Unclassified | 4521 |
| 193 | Ga0466729_002388 | 3300042621 | Bacteria | 1893 |
| 194 | Ga0123355_10000640 | 3300009826 | Bacteria | 47434 |
| 195 | Ga0123356_10319794 | 3300010049 | Bacteria | 1664 |
| 196 | Ga0123356_11429135 | 3300010049 | Bacteria | 851 |
| 197 | Ga0123353_10009076 | 3300010167 | Bacteria | 13672 |
| 198 | Ga0123353_10638409 | 3300010167 | Unclassified | 1511 |
| 199 | Ga0123353_10854046 | 3300010167 | Bacteria | 1247 |
| 200 | Ga0123353_10981028 | 3300010167 | Bacteria | 1138 |
| 201 | Ga0123354_10064884 | 3300010882 | Bacteria | 5349 |
| 202 | Ga0123354_10319702 | 3300010882 | Bacteria | 1434 |
| 203 | Ga0466706_163906 | 3300042599 | Bacteria | 105365 |
| 204 | Ga0466706_249716 | 3300042599 | Unclassified | 37265 |
| 205 | Ga0466707_005688 | 3300042601 | Bacteria | 1522 |
| 206 | Ga0466707_077425 | 3300042601 | Bacteria | 32634 |
| 207 | Ga0466707_178537 | 3300042601 | Bacteria | 3152 |
| 208 | Ga0466707_314673 | 3300042601 | Bacteria | 1413 |
| 209 | Ga0466717_290355 | 3300042604 | Bacteria | 4250 |
| 210 | Ga0466722_121357 | 3300042609 | Bacteria | 1061 |
| 211 | Nasutiter_Contig44362 | 2030936001 | Bacteria | 753 |
| 212 | AustNasuHG_c1005671 | 3300000089 | Bacteria | 4467 |
| 213 | JGI24698J34947_10007219 | 3300002449 | Bacteria | 6104 |
| 214 | JGI24698J34947_10007586 | 3300002449 | Unclassified | 5961 |
| 215 | JGI24698J34947_10045988 | 3300002449 | Bacteria | 2223 |
| 216 | JGI24698J34947_10089428 | 3300002449 | Unclassified | 1418 |
| 217 | JGI24702J35022_10009111 | 3300002462 | Bacteria | 5590 |
| 218 | JGI24702J35022_10071832 | 3300002462 | Bacteria | 1865 |
| 219 | JGI24705J35276_12232457 | 3300002504 | Bacteria | 4341 |
| 220 | Ga0466727_316689 | 3300042655 | Bacteria | 58164 |
| 221 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 222 | Ga0466690_213693 | 3300042590 | Bacteria | 64603 |
| 223 | Ga0466693_157988 | 3300042592 | Bacteria | 1449 |
| 224 | Ga0466699_155236 | 3300042597 | Bacteria | 5552 |
| 225 | Ga0466711_098330 | 3300042615 | Bacteria | 3930 |
| 226 | Ga0466715_557724 | 3300042616 | Bacteria | 19130 |
| 227 | Ga0466718_047296 | 3300042617 | Bacteria | 1211 |
| 228 | Ga0466718_107111 | 3300042617 | Bacteria | 1386 |
| 229 | Ga0466726_223073 | 3300042619 | Bacteria | 10114 |
| 230 | Ga0123355_10227114 | 3300009826 | Unclassified | 2673 |
| 231 | Ga0123356_10005960 | 3300010049 | Unclassified | 12370 |
| 232 | Ga0123356_10038491 | 3300010049 | Bacteria | 4457 |
| 233 | Ga0123356_10157158 | 3300010049 | Bacteria | 2266 |
| 234 | Ga0123356_10237114 | 3300010049 | Bacteria | 1893 |
| 235 | Ga0123353_10011648 | 3300010167 | Bacteria | 12409 |
| 236 | Ga0123353_10049117 | 3300010167 | Bacteria | 6720 |
| 237 | Ga0123353_10178809 | 3300010167 | Bacteria | 3361 |
| 238 | Ga0123353_10299673 | 3300010167 | Bacteria | 2455 |
| 239 | Ga0123353_10780022 | 3300010167 | Bacteria | 1324 |
| 240 | Ga0123353_10892180 | 3300010167 | Bacteria | 1212 |
| 241 | Ga0123353_11546863 | 3300010167 | Bacteria | 841 |
| 242 | Ga0123354_10132415 | 3300010882 | Bacteria | 3140 |
| 243 | Ga0123354_10328029 | 3300010882 | Bacteria | 1400 |
| 244 | Ga0466701_100972 | 3300042598 | Bacteria | 1604 |
| 245 | Ga0466700_170326 | 3300042600 | Bacteria | 14546 |
| 246 | Ga0466713_047562 | 3300042602 | Bacteria | 37321 |
| 247 | Ga0466713_061722 | 3300042602 | Bacteria | 16595 |
| 248 | Ga0466713_154951 | 3300042602 | Unclassified | 4293 |
| 249 | Ga0466719_296992 | 3300042606 | Unclassified | 1479 |
| 250 | Ga0466722_025533 | 3300042609 | Bacteria | 15373 |
| 251 | Ga0466698_108829 | 3300042610 | Bacteria | 1234 |
| 252 | JGI24698J34947_10004187 | 3300002449 | Bacteria | 7840 |
| 253 | JGI24698J34947_10075048 | 3300002449 | Unclassified | 1609 |
| 254 | JGI24695J34938_10000023 | 3300002450 | Bacteria | 110103 |
| 255 | Ga0068305_10009344 | 3300005083 | Bacteria | 20262 |
| 256 | Ga0466729_273084 | 3300042621 | Bacteria | 1094 |
| 257 | Ga0466705_081544 | 3300042612 | Bacteria | 12858 |
| 258 | Ga0466732_417427 | 3300042656 | Bacteria | 1316 |
| 259 | Ga0456237_0018306 | 3300041968 | Bacteria | 980 |
| 260 | Ga0466693_269532 | 3300042592 | Bacteria | 1111 |
| 261 | Ga0466694_238852 | 3300042594 | Bacteria | 1023 |
| 262 | Ga0466696_185083 | 3300042596 | Bacteria | 1180 |
| 263 | Ga0466696_237129 | 3300042596 | Bacteria | 2595 |
| 264 | Ga0466699_062998 | 3300042597 | Bacteria | 2820 |
| 265 | Ga0466712_120522 | 3300042614 | Bacteria | 21561 |
| 266 | Ga0466712_137351 | 3300042614 | Unclassified | 1530 |
| 267 | Ga0466712_268644 | 3300042614 | Bacteria | 11036 |
| 268 | Ga0466711_169261 | 3300042615 | Bacteria | 34070 |
| 269 | Ga0466726_449969 | 3300042619 | Bacteria | 1228 |
| 270 | Ga0123357_10090635 | 3300009784 | Bacteria | 3987 |
| 271 | Ga0123357_10615415 | 3300009784 | Bacteria | 825 |
| 272 | Ga0123355_10388325 | 3300009826 | Bacteria | 1812 |
| 273 | Ga0123356_10000883 | 3300010049 | Bacteria | 33283 |
| 274 | Ga0123356_10014307 | 3300010049 | Bacteria | 7634 |
| 275 | Ga0123356_10018042 | 3300010049 | Bacteria | 6703 |
| 276 | Ga0123356_10021318 | 3300010049 | Bacteria | 6115 |
| 277 | Ga0123356_10172000 | 3300010049 | Bacteria | 2178 |
| 278 | Ga0123356_10702408 | 3300010049 | Bacteria | 1180 |
| 279 | Ga0123356_10765274 | 3300010049 | Unclassified | 1136 |
| 280 | Ga0123356_11143989 | 3300010049 | Bacteria | 946 |
| 281 | Ga0123356_11739860 | 3300010049 | Bacteria | 774 |
| 282 | Ga0123356_12665196 | 3300010049 | Bacteria | 626 |
| 283 | Ga0123353_10001917 | 3300010167 | Bacteria | 25568 |
| 284 | Ga0123353_10089039 | 3300010167 | Bacteria | 4970 |
| 285 | Ga0123353_10442165 | 3300010167 | Bacteria | 1918 |
| 286 | Ga0123353_11264338 | 3300010167 | Bacteria | 962 |
| 287 | Ga0123354_10011171 | 3300010882 | Unclassified | 13858 |
| 288 | Ga0123354_10340522 | 3300010882 | Bacteria | 1352 |
| 289 | Ga0123354_10563174 | 3300010882 | Bacteria | 853 |
| 290 | Ga0466707_146506 | 3300042601 | Bacteria | 12733 |
| 291 | Ga0466713_133261 | 3300042602 | Bacteria | 102519 |
| 292 | Ga0466717_269061 | 3300042604 | Bacteria | 2083 |
| 293 | Ga0466719_202519 | 3300042606 | Bacteria | 25647 |
| 294 | Ga0466720_066572 | 3300042607 | Unclassified | 2076 |
| 295 | Ga0466722_013231 | 3300042609 | Bacteria | 1941 |
| 296 | Ga0466722_022023 | 3300042609 | Bacteria | 11127 |
| 297 | Ga0466722_030168 | 3300042609 | Bacteria | 24541 |
| 298 | Ga0466698_494812 | 3300042610 | Bacteria | 2373 |
| 299 | 2227066911 | 2225789003 | Bacteria | 14705 |
| 300 | 2230954922 | 2228664003 | Bacteria | 666 |
| 301 | IMNBL1DRAFT_c0000122 | 3300000062 | Bacteria | 69156 |
| 302 | JGI24698J34947_10005412 | 3300002449 | Bacteria | 7003 |
| 303 | JGI24698J34947_10054020 | 3300002449 | Unclassified | 2008 |
| 304 | JGI24702J35022_10016911 | 3300002462 | Bacteria | 3993 |
| 305 | JGI24702J35022_10024880 | 3300002462 | Bacteria | 3233 |
| 306 | Ga0068305_10002253 | 3300005083 | Unclassified | 63545 |
| 307 | Ga0466729_217820 | 3300042621 | Bacteria | 1693 |
| 308 | Ga0466734_058396 | 3300042623 | Bacteria | 2557 |
| 309 | Ga0466702_297617 | 3300042635 | Unclassified | 1269 |
| 310 | Ga0466709_406548 | 3300042648 | Bacteria | 104395 |
| 311 | Ga0466725_300651 | 3300042654 | Bacteria | 7882 |
| 312 | Ga0466733_107067 | 3300042659 | Bacteria | 43860 |
| 313 | Ga0264413_108192 | 3300024493 | Bacteria | 10641 |
| 314 | Ga0415639_098365 | 3300038395 | Unclassified | 2079 |
| 315 | Ga0456237_0001853 | 3300041968 | Bacteria | 3406 |
| 316 | Ga0466699_296623 | 3300042597 | Bacteria | 3197 |
| 317 | Ga0466712_147267 | 3300042614 | Unclassified | 2316 |
| 318 | Ga0123357_10060979 | 3300009784 | Bacteria | 5056 |
| 319 | Ga0123355_10182331 | 3300009826 | Bacteria | 3113 |
| 320 | Ga0123356_10015780 | 3300010049 | Bacteria | 7227 |
| 321 | Ga0123356_10054841 | 3300010049 | Bacteria | 3712 |
| 322 | Ga0123356_10059139 | 3300010049 | Bacteria | 3575 |
| 323 | Ga0123356_10221583 | 3300010049 | Bacteria | 1948 |
| 324 | Ga0123356_10242891 | 3300010049 | Bacteria | 1873 |
| 325 | Ga0123356_11552229 | 3300010049 | Bacteria | 818 |
| 326 | Ga0123353_10007670 | 3300010167 | Bacteria | 14622 |
| 327 | Ga0123353_10010906 | 3300010167 | Bacteria | 12735 |
| 328 | Ga0123353_10039045 | 3300010167 | Bacteria | 7468 |
| 329 | Ga0123353_10044021 | 3300010167 | Bacteria | 7075 |
| 330 | Ga0123353_10256729 | 3300010167 | Bacteria | 2703 |
| 331 | Ga0123353_10340947 | 3300010167 | Bacteria | 2263 |
| 332 | Ga0466701_091071 | 3300042598 | Unclassified | 4731 |
| 333 | Ga0466706_002391 | 3300042599 | Bacteria | 31652 |
| 334 | Ga0466706_126449 | 3300042599 | Bacteria | 1431 |
| 335 | Ga0466706_218636 | 3300042599 | Bacteria | 1443 |
| 336 | Ga0466706_235862 | 3300042599 | Bacteria | 2479 |
| 337 | Ga0466707_251685 | 3300042601 | Bacteria | 9699 |
| 338 | Ga0466707_398421 | 3300042601 | Bacteria | 1742 |
| 339 | Ga0466714_026521 | 3300042603 | Bacteria | 2886 |
| 340 | Ga0466717_077911 | 3300042604 | Bacteria | 1639 |
| 341 | Ga0466720_042210 | 3300042607 | Unclassified | 5659 |
| 342 | Ga0466720_043437 | 3300042607 | Bacteria | 1973 |
| 343 | Ga0466722_117512 | 3300042609 | Bacteria | 10548 |
| 344 | 2227521297 | 2225789004 | Unclassified | 3336 |
| 345 | AustNasuHG_c1014361 | 3300000089 | Unclassified | 2696 |
| 346 | AustNasuHG_c1015668 | 3300000089 | Bacteria | 2553 |
| 347 | JGI24698J34947_10139105 | 3300002449 | Unclassified | 1026 |
| 348 | JGI24695J34938_10000079 | 3300002450 | Bacteria | 82620 |
| 349 | JGI24695J34938_10000359 | 3300002450 | Bacteria | 45052 |
| 350 | JGI24702J35022_10063176 | 3300002462 | Bacteria | 1983 |
| 351 | Ga0466731_247326 | 3300042622 | Bacteria | 1204 |
| 352 | Ga0466734_030589 | 3300042623 | Bacteria | 1267 |
| 353 | Ga0466735_179482 | 3300042624 | Bacteria | 3782 |
| 354 | Ga0466703_432420 | 3300042636 | Unclassified | 3064 |
| 355 | Ga0466704_126797 | 3300042643 | Unclassified | 9278 |
| 356 | Ga0466704_189598 | 3300042643 | Unclassified | 3864 |
| 357 | Ga0466725_281795 | 3300042654 | Bacteria | 2250 |
| 358 | Ga0466727_214739 | 3300042655 | Bacteria | 1379 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.