Protein Family IF08998
Metagenome
Isolate
286
Members
187
Samples
158
Scaffolds
398.4
Avg Length
Representative Sequence
- ID
- 3300042625|Ga0466730_072965|Ga0466730_072965_121_1542
- Length
- 473 aa
- Sequence
- MLNAYMYAGKRSPFGRYAGALAKKRPDDMLADVIASVVAESGFEPEKIEDVVVGCGNQGGEDSRCVARHAALVAGLPIEVPGSVLQRNCGSGLNAIAVAAQQITCGEGDIFVAGGVESMSRAPWVMAKGENPYSREMRIFDSTIGARFPNPKVESRFGVDTMPQTADNLARDYQISREQADIFANASQAKYAAGRKDGFFDGEIVAIEVPGGRAGPVTVAEDEHPRPQTDMAGLAKLRPLFADGVTTAGNASGVNDGAVAMIVASRHAGEKAGQQPLCRILSTGVAGVAPRIMGYGPVPAAKKALERAGLTIADMDVIEINEAFASQVLACLKGLEVSFDDSRVNPNGGAIAIGHPLGASGPRIALTAARQLQRVGGKYALVAMCVGVGQGIAAVIERVSLIACSQPGPLGRTPRPHEHGLSPFEGADRVHGLRARCRAAPRNDNGLGVIRRYCPSAANLRRSRRLSAVSCRE
Sample Types
Isolate
44.8%
Metagenome
55.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Elmidae
15.8%
Unclassified
13.6%
Formicidae
12.4%
Termitidae
11.3%
Culicidae
9.0%
Drosophilidae
6.8%
Curculionidae
6.8%
Anthocoridae
6.2%
Apidae
4.5%
Armadillidiidae
3.4%
Tenebrionidae
2.8%
Kalotermitidae
1.1%
Hydrophilidae
1.1%
Trigoniulidae
0.6%
Daphniidae
0.6%
Nephropidae
0.6%
Rhinotermitidae
0.6%
Siricidae
0.6%
Passalidae
0.6%
Termopsidae
0.6%
Crambidae
0.6%
Muscidae
0.6%
Taxonomy
Archaea
0
Bacteria
261
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2513237339 | Commensalibacter intestini A911 | Isolate | Drosophilidae |
| 2 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 3 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 4 | 2711768164 | Tritonibacter mobilis S1942 | Isolate | Unclassified |
| 5 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 6 | 2816332545 | Tritonibacter mobilis S1923 | Isolate | Unclassified |
| 7 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 8 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 9 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 10 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 14 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 15 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 16 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 17 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 18 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 19 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 20 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 21 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 22 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 23 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 24 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 25 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 26 | 2835143510 | Yoonia maritima YPC211 | Isolate | Nephropidae |
| 27 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 28 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 29 | 2858110640 | Acetobacter indonesiensis DmL_051 | Isolate | Drosophilidae |
| 30 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 31 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 32 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 33 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 34 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 35 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 36 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 37 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 40 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 41 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 42 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 43 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 44 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 45 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 46 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 47 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 48 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 49 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 50 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 51 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 52 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 53 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 54 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 55 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 56 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 57 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 58 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 59 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 60 | 2816332503 | Tritonibacter mobilis S1611 | Isolate | Unclassified |
| 61 | 2835008077 | Commensalibacter intestini DmL_052 | Isolate | Drosophilidae |
| 62 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 63 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 64 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 65 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 66 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 67 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 68 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 69 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 70 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 71 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 72 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 73 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 74 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 75 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 76 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 77 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 78 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 79 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 80 | 3300007506 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 3 gut | Metagenome | Drosophilidae |
| 81 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 82 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 83 | 3300005322 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 1 gut | Metagenome | Drosophilidae |
| 84 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 85 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 86 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 87 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 88 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 89 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 90 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 91 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 92 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 93 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 94 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 95 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 96 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 97 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 98 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 99 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 100 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 101 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 102 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 103 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 104 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 105 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 106 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 107 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 108 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 109 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 110 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 111 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 112 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 113 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 114 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 115 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 116 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 117 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 118 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 119 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 120 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 121 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 122 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 123 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 124 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 125 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 126 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 127 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 128 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 129 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 130 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 131 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 132 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 133 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 134 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 135 | 2854518031 | Acetobacter indonesiensis DmW_046 | Isolate | Drosophilidae |
| 136 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 137 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 138 | 2873196663 | Streptomyces capitiformicae 1H-SSA4 | Isolate | Formicidae |
| 139 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 140 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 141 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 142 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 143 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 144 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 145 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 146 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 147 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 148 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 149 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 150 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 151 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 152 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 153 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 154 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 155 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 156 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 157 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 158 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 159 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 160 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 161 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 162 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 163 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 164 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 165 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 166 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 167 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 168 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 169 | 2718218026 | Phaeobacter porticola P97 | Isolate | Unclassified |
| 170 | 2841330038 | Sulfitobacter sp. D7 | Isolate | |
| 171 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 172 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 173 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 174 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 175 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 176 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 177 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 178 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 179 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 180 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 181 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 182 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 183 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 184 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 185 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 186 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 187 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0530661_000446 | 3300056564 | Bacteria | 30639 |
| 2 | Ga0466701_074264 | 3300042598 | Bacteria | 71704 |
| 3 | SWWA_contig02174__length_4576___numreads_246 | 2100351016 | Unclassified | 4576 |
| 4 | Ga0063521_1004539 | 3300003973 | Bacteria | 3280 |
| 5 | Ga0103267_1000272 | 3300007190 | Bacteria | 19078 |
| 6 | Ga0466726_168476 | 3300042619 | Bacteria | 10511 |
| 7 | Ga0466731_222922 | 3300042622 | Bacteria | 6925 |
| 8 | Ga0466730_060188 | 3300042625 | Bacteria | 807184 |
| 9 | Ga0466730_092809 | 3300042625 | Bacteria | 164860 |
| 10 | Ga0466704_098176 | 3300042643 | Bacteria | 15503 |
| 11 | Ga0466724_39588 | 3300042649 | Bacteria | 96893 |
| 12 | Ga0466725_150585 | 3300042654 | Bacteria | 2280 |
| 13 | Ga0160470_100417 | 3300012813 | Bacteria | 19755 |
| 14 | Ga0160456_100258 | 3300012820 | Bacteria | 24548 |
| 15 | Ga0160459_102744 | 3300012831 | Bacteria | 2738 |
| 16 | Ga0160447_102553 | 3300012849 | Unclassified | 6298 |
| 17 | Ga0160435_1004513 | 3300012857 | Bacteria | 3222 |
| 18 | Ga0160435_1008397 | 3300012857 | Bacteria | 2227 |
| 19 | Ga0466657_028417 | 3300042582 | Bacteria | 16384 |
| 20 | Ga0466693_222223 | 3300042592 | Bacteria | 6633 |
| 21 | Ga0530661_000055 | 3300056564 | Bacteria | 113139 |
| 22 | Ga0466721_005758 | 3300042608 | Bacteria | 5828 |
| 23 | Ga0466722_067480 | 3300042609 | Bacteria | 2154 |
| 24 | Ga0103263_102969 | 3300007042 | Unclassified | 2056 |
| 25 | Ga0103266_1000008 | 3300007067 | Bacteria | 116820 |
| 26 | Ga0103265_1001239 | 3300007068 | Unclassified | 8762 |
| 27 | Ga0102739_1001538 | 3300007095 | Unclassified | 3775 |
| 28 | Ga0102739_1005912 | 3300007095 | Unclassified | 1659 |
| 29 | Ga0102734_1008311 | 3300007129 | Bacteria | 2363 |
| 30 | Ga0102737_1000453 | 3300007142 | Unclassified | 16275 |
| 31 | Ga0103267_1000196 | 3300007190 | Bacteria | 23686 |
| 32 | Ga0105005_1033258 | 3300007505 | Bacteria | 4609 |
| 33 | Ga0466731_085328 | 3300042622 | Bacteria | 6014 |
| 34 | Ga0466724_27985 | 3300042649 | Unclassified | 2528 |
| 35 | Ga0466724_42798 | 3300042649 | Bacteria | 5906 |
| 36 | Ga0466708_280888 | 3300042652 | Bacteria | 6071 |
| 37 | Ga0466725_314703 | 3300042654 | Bacteria | 12602 |
| 38 | Ga0123354_10024217 | 3300010882 | Bacteria | 9577 |
| 39 | Ga0160454_100142 | 3300012798 | Unclassified | 86682 |
| 40 | Ga0160465_100221 | 3300012803 | Bacteria | 43362 |
| 41 | Ga0160459_100028 | 3300012831 | Bacteria | 313883 |
| 42 | Ga0466693_065090 | 3300042592 | Bacteria | 3151 |
| 43 | Ga0466701_003484 | 3300042598 | Bacteria | 69339 |
| 44 | Ga0466701_013189 | 3300042598 | Bacteria | 96993 |
| 45 | Ga0562377_0002 | 3300056842 | Bacteria | 4351833 |
| 46 | SPBB_contig11583 | 2044078006 | Unclassified | 26219 |
| 47 | Ga0063521_1000894 | 3300003973 | Bacteria | 9995 |
| 48 | Ga0074314_1006564 | 3300005322 | Unclassified | 2677 |
| 49 | Ga0102736_1000141 | 3300007052 | Bacteria | 17581 |
| 50 | Ga0103266_1000344 | 3300007067 | Bacteria | 15731 |
| 51 | Ga0102740_1001027 | 3300007140 | Bacteria | 7365 |
| 52 | Ga0102738_1000085 | 3300007141 | Bacteria | 35218 |
| 53 | Ga0103268_1000003 | 3300007192 | Bacteria | 104067 |
| 54 | Ga0466734_070912 | 3300042623 | Bacteria | 1800 |
| 55 | Ga0466730_101108 | 3300042625 | Bacteria | 144008 |
| 56 | Ga0466725_149227 | 3300042654 | Bacteria | 2326 |
| 57 | Ga0123355_10121295 | 3300009826 | Bacteria | 4054 |
| 58 | Ga0123356_10004079 | 3300010049 | Bacteria | 15175 |
| 59 | Ga0123356_10148299 | 3300010049 | Bacteria | 2325 |
| 60 | Ga0160471_100402 | 3300012812 | Bacteria | 12801 |
| 61 | Ga0160456_100128 | 3300012820 | Bacteria | 73531 |
| 62 | Ga0160467_100019 | 3300012829 | Bacteria | 324781 |
| 63 | Ga0160455_100181 | 3300012837 | Bacteria | 63267 |
| 64 | Ga0160472_100062 | 3300012839 | Bacteria | 179638 |
| 65 | Ga0160444_104028 | 3300012841 | Unclassified | 2036 |
| 66 | Ga0160436_1001779 | 3300012861 | Unclassified | 5721 |
| 67 | Ga0466695_041689 | 3300042595 | Bacteria | 4799 |
| 68 | Ga0466695_211148 | 3300042595 | Bacteria | 6935 |
| 69 | Ga0466701_018128 | 3300042598 | Bacteria | 118598 |
| 70 | Ga0466722_256114 | 3300042609 | Bacteria | 3845 |
| 71 | DPOL_contig00353 | 2035918003 | Bacteria | 12499 |
| 72 | DPOL_contig06724 | 2035918003 | Unclassified | 2133 |
| 73 | Ga0102735_1000044 | 3300007080 | Unclassified | 37422 |
| 74 | Ga0103264_1016176 | 3300007188 | Bacteria | 3654 |
| 75 | Ga0466734_007569 | 3300042623 | Bacteria | 5677 |
| 76 | Ga0466734_145085 | 3300042623 | Bacteria | 1428 |
| 77 | Ga0123357_10265365 | 3300009784 | Bacteria | 1806 |
| 78 | Ga0123356_10013590 | 3300010049 | Unclassified | 7850 |
| 79 | Ga0160442_100103 | 3300012806 | Bacteria | 97974 |
| 80 | Ga0160467_100016 | 3300012829 | Bacteria | 336522 |
| 81 | Ga0160455_100881 | 3300012837 | Bacteria | 11378 |
| 82 | Ga0160430_113304 | 3300012852 | Bacteria | 1305 |
| 83 | Ga0466657_309688 | 3300042582 | Unclassified | 3357 |
| 84 | Ga0466701_012301 | 3300042598 | Unclassified | 3719 |
| 85 | Ga0530661_001535 | 3300056564 | Bacteria | 11200 |
| 86 | Ga0562378_0001 | 3300056814 | Bacteria | 3579584 |
| 87 | Ga0562377_0177 | 3300056842 | Bacteria | 171910 |
| 88 | CVPL010W_10003849 | 3300002931 | Bacteria | 25974 |
| 89 | Ga0103263_103163 | 3300007042 | Unclassified | 1979 |
| 90 | Ga0105006_1015832 | 3300007506 | Unclassified | 36533 |
| 91 | Ga0466731_326474 | 3300042622 | Bacteria | 4493 |
| 92 | Ga0466734_145844 | 3300042623 | Bacteria | 2185 |
| 93 | Ga0466724_29472 | 3300042649 | Bacteria | 417400 |
| 94 | Ga0466724_57906 | 3300042649 | Bacteria | 581904 |
| 95 | Ga0123355_10571365 | 3300009826 | Bacteria | 1356 |
| 96 | Ga0160455_101924 | 3300012837 | Bacteria | 5069 |
| 97 | Ga0160436_1003303 | 3300012861 | Bacteria | 3963 |
| 98 | Ga0466697_217978 | 3300042611 | Bacteria | 5804 |
| 99 | Ga0466701_101824 | 3300042598 | Bacteria | 199707 |
| 100 | CVPL005W_1000329 | 3300002934 | Bacteria | 20623 |
| 101 | Ga0102736_1000212 | 3300007052 | Bacteria | 13363 |
| 102 | Ga0103264_1000034 | 3300007188 | Bacteria | 107523 |
| 103 | Ga0466730_072965 | 3300042625 | Bacteria | 2768 |
| 104 | Ga0466724_28807 | 3300042649 | Unclassified | 2530 |
| 105 | Ga0466724_53791 | 3300042649 | Bacteria | 252935 |
| 106 | Ga0123356_10046435 | 3300010049 | Bacteria | 4040 |
| 107 | Ga0123354_10037053 | 3300010882 | Bacteria | 7595 |
| 108 | Ga0160471_100227 | 3300012812 | Bacteria | 19338 |
| 109 | Ga0160453_105033 | 3300012814 | Bacteria | 2251 |
| 110 | Ga0160431_102184 | 3300012828 | Unclassified | 4807 |
| 111 | Ga0160447_101051 | 3300012849 | Bacteria | 11313 |
| 112 | Ga0255572_1000007 | 3300026175 | Bacteria | 235375 |
| 113 | Ga0466656_228108 | 3300042550 | Bacteria | 1437 |
| 114 | Ga0562376_5565 | 3300056857 | Bacteria | 7885 |
| 115 | Ga0466701_022011 | 3300042598 | Bacteria | 293822 |
| 116 | FGTW_contig30500 | 2065487013 | Bacteria | 11554 |
| 117 | CVPL005L_10000868 | 3300002938 | Bacteria | 33423 |
| 118 | Ga0102737_1005474 | 3300007142 | Bacteria | 2527 |
| 119 | Ga0466710_025081 | 3300042613 | Bacteria | 6773 |
| 120 | Ga0466726_405188 | 3300042619 | Bacteria | 10936 |
| 121 | Ga0466734_008182 | 3300042623 | Bacteria | 2343 |
| 122 | Ga0466734_040715 | 3300042623 | Bacteria | 26399 |
| 123 | Ga0466730_035584 | 3300042625 | Bacteria | 4174 |
| 124 | Ga0466724_00673 | 3300042649 | Bacteria | 19967 |
| 125 | Ga0466724_40074 | 3300042649 | Bacteria | 90242 |
| 126 | Ga0466725_416947 | 3300042654 | Bacteria | 37910 |
| 127 | Ga0123355_10056154 | 3300009826 | Bacteria | 6373 |
| 128 | Ga0123356_10001484 | 3300010049 | Bacteria | 25834 |
| 129 | Ga0160469_100169 | 3300012824 | Bacteria | 66413 |
| 130 | Ga0160444_100079 | 3300012841 | Bacteria | 129479 |
| 131 | Ga0160433_100002 | 3300012846 | Bacteria | 625007 |
| 132 | Ga0160448_103813 | 3300012854 | Bacteria | 4325 |
| 133 | Ga0160436_1007614 | 3300012861 | Bacteria | 2463 |
| 134 | Ga0466657_123156 | 3300042582 | Bacteria | 1956 |
| 135 | Ga0466693_177351 | 3300042592 | Bacteria | 2329 |
| 136 | Ga0562376_1263 | 3300056857 | Bacteria | 36547 |
| 137 | Ga0466701_055175 | 3300042598 | Bacteria | 174968 |
| 138 | DPOL_contig14452 | 2035918003 | Unclassified | 21633 |
| 139 | 2227080768 | 2225789004 | Bacteria | 273152 |
| 140 | Meta3P_1001368 | 3300002464 | Bacteria | 42789 |
| 141 | Ga0102734_1020658 | 3300007129 | Bacteria | 2312 |
| 142 | Ga0103264_1000030 | 3300007188 | Bacteria | 85624 |
| 143 | Ga0103268_1000680 | 3300007192 | Unclassified | 9791 |
| 144 | Ga0466730_041492 | 3300042625 | Bacteria | 1454 |
| 145 | Ga0466730_063290 | 3300042625 | Bacteria | 7898 |
| 146 | Ga0466724_22014 | 3300042649 | Bacteria | 158058 |
| 147 | Ga0466724_22131 | 3300042649 | Bacteria | 88081 |
| 148 | Ga0466725_343874 | 3300042654 | Bacteria | 14158 |
| 149 | Ga0123355_10404770 | 3300009826 | Bacteria | 1757 |
| 150 | Ga0123353_10296063 | 3300010167 | Bacteria | 2474 |
| 151 | Ga0160470_104065 | 3300012813 | Bacteria | 2175 |
| 152 | Ga0160458_100513 | 3300012832 | Unclassified | 15602 |
| 153 | Ga0160458_104029 | 3300012832 | Bacteria | 1803 |
| 154 | Ga0160446_100022 | 3300012835 | Bacteria | 226564 |
| 155 | Ga0160433_100094 | 3300012846 | Bacteria | 90402 |
| 156 | Ga0160433_100112 | 3300012846 | Bacteria | 78342 |
| 157 | Ga0160436_1003904 | 3300012861 | Bacteria | 3605 |
| 158 | Ga0466656_272975 | 3300042550 | Bacteria | 8480 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02803 | GO:0016747 | acyltransferase activity, transferring groups other than amino-acyl groups | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.