Protein Family IF08899
Metagenome
Isolate
459
Members
392
Samples
124
Scaffolds
272.01
Avg Length
Representative Sequence
- ID
- 3300042625|Ga0466730_017562|Ga0466730_017562_3491_4441
- Length
- 316 aa
- Sequence
- MLFTDNPFGFTLNSNYRRFQMATPADAGYSEKRFTCNQLKRIDMHDAQIRVAIAGAGGRMGRQLIQAAAQLDGVQLGAALEREGSSLLGSDAGELAGSGNSGVTVQSSLQAVKDDFDIFIDFTRPEGTLAHLAFCRKNGKGMIIGTTGFDDAGKQAIQAAAQDIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAQALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERVEITHKASSRMTFANGAVRSALWLKGKKNGLFDMRDVLDLNNL
Sample Types
Isolate
73.0%
Metagenome
27.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
41.8%
Unclassified
11.7%
Drosophilidae
6.5%
Anthocoridae
5.5%
Elmidae
3.9%
Curculionidae
3.9%
Muscidae
3.4%
Formicidae
2.9%
Tenebrionidae
2.6%
Termitidae
2.3%
Calliphoridae
2.3%
Culicidae
1.8%
Tephritidae
1.3%
Cerambycidae
1.0%
Aphididae
1.0%
Pteromalidae
0.8%
Kalotermitidae
0.8%
Hydrophilidae
0.5%
Pentatomidae
0.5%
Sarcophagidae
0.5%
Passalidae
0.5%
Daphniidae
0.3%
Reduviidae
0.3%
Rhopalidae
0.3%
Plutellidae
0.3%
Carabidae
0.3%
Hippoboscidae
0.3%
Thripidae
0.3%
Anthomyiidae
0.3%
Armadillidiidae
0.3%
Alydidae
0.3%
Rhinotermitidae
0.3%
Largidae
0.3%
Scarabaeidae
0.3%
Ceratophyllidae
0.3%
Trigoniulidae
0.3%
Crambidae
0.3%
Aleyrodidae
0.3%
Taxonomy
Archaea
0
Bacteria
438
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 2 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 3 | 2515154047 | Candidatus Gilliamella apicola wkB1 | Isolate | Apidae |
| 4 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 5 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 6 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 7 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 8 | 2684622921 | Frischella perrara Fp_167 | Isolate | Unclassified |
| 9 | 2684622923 | Gilliamella apicola Ga_172 | Isolate | Unclassified |
| 10 | 2684622925 | Gilliamella apicola Ga_178 | Isolate | Unclassified |
| 11 | 2684622926 | Gilliamella apicola Ga_182 | Isolate | Unclassified |
| 12 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 13 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 14 | 2833532623 | Frischella perrara ESL0167 | Isolate | Apidae |
| 15 | 2840795165 | Gilliamella apicola N-22 | Isolate | Apidae |
| 16 | 2846483029 | Gilliamella apis AM1 | Isolate | Apidae |
| 17 | 2849466174 | Gilliamella apis P83G | Isolate | Apidae |
| 18 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 19 | 2854134697 | Gilliamella apicola Fer4-1 | Isolate | Apidae |
| 20 | 2854144746 | Gilliamella apicola NO6 | Isolate | Apidae |
| 21 | 2854149989 | Gilliamella apis A-TSA1 | Isolate | Apidae |
| 22 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 23 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 24 | 2857870431 | Gilliamella apicola A-7-24 | Isolate | Apidae |
| 25 | 2857873190 | Gilliamella apicola Nev5-1 | Isolate | Apidae |
| 26 | 2857886120 | Gilliamella apicola Bim1-2 | Isolate | Apidae |
| 27 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 28 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 29 | 2868492035 | Gilliamella apicola Occ4-3 | Isolate | Apidae |
| 30 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 31 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 32 | 2876019154 | Gilliamella apicola ESL0182 | Isolate | Apidae |
| 33 | 2876030618 | Gilliamella apicola HK2 | Isolate | Apidae |
| 34 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 35 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 36 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 37 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 38 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 39 | 3300000490 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 | Metagenome | Apidae |
| 40 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 41 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 42 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 43 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 44 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 45 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 46 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 47 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 48 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 49 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 50 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 51 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 52 | 2505679062 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 53 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 54 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 55 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 56 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 57 | 2684622922 | Gilliamella apicola Ga_169 | Isolate | Unclassified |
| 58 | 2756170266 | Frischella perrara DSM 104328 | Isolate | Unclassified |
| 59 | 2785510746 | Gilliamella sp. ESL0441 | Isolate | Apidae |
| 60 | 2785510747 | Gilliamella sp. ESL0443 | Isolate | Apidae |
| 61 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 62 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 63 | 2837615801 | Gilliamella apicola ESL0177 | Isolate | Apidae |
| 64 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 65 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 66 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 67 | 2846485327 | Gilliamella apicola AM4 | Isolate | Apidae |
| 68 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 69 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 70 | 2849471304 | Gilliamella apicola NO5 | Isolate | Apidae |
| 71 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 72 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 73 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 74 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 75 | 2873643457 | Gilliamella apis A-4-12 | Isolate | Apidae |
| 76 | 2876011797 | Gilliamella apis NO16 | Isolate | Apidae |
| 77 | 2876022486 | Gilliamella apicola A8 | Isolate | Apidae |
| 78 | 2876027665 | Gilliamella apicola P54G | Isolate | Apidae |
| 79 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 80 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 81 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 82 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 83 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 84 | 3300000462 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 | Metagenome | Apidae |
| 85 | 3300005306 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 1 gut | Metagenome | Drosophilidae |
| 86 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 87 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 88 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 89 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 90 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 91 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 92 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 93 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 94 | 8088491222 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 95 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 96 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 97 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 98 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 99 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 100 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 101 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 102 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 103 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 104 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 105 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 106 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 107 | 2840797934 | Gilliamella apicola Choc5-1 | Isolate | Apidae |
| 108 | 2846472545 | Gilliamella sp. N-W3 | Isolate | Apidae |
| 109 | 2846475167 | Gilliamella apicola N-G5 | Isolate | Apidae |
| 110 | 2846493360 | Gilliamella apis N-G1 | Isolate | Apidae |
| 111 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 112 | 2854132136 | Gilliamella apicola wkB292 | Isolate | Apidae |
| 113 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 114 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 115 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 116 | 2857888719 | Gilliamella apicola N-15-12 | Isolate | Apidae |
| 117 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 118 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 119 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 120 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 121 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 122 | 2870908367 | Gilliamella apis NO13 | Isolate | Apidae |
| 123 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 124 | 2873648542 | Gilliamella apicola NO10 | Isolate | Apidae |
| 125 | 2873653628 | Gilliamella apicola App6-5 | Isolate | Apidae |
| 126 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 127 | 2876014139 | Gilliamella apicola wkB18 | Isolate | Apidae |
| 128 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 129 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 130 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 131 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 132 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 133 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 134 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 135 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 136 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 137 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 138 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 139 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 140 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 141 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 142 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 143 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 144 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 145 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 146 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 147 | 2837618715 | Gilliamella apicola Aw-17 | Isolate | Apidae |
| 148 | 2841195917 | Gilliamella apicola wkB7 | Isolate | Apidae |
| 149 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 150 | 2846495668 | Gilliamella apicola ESL0178 | Isolate | Apidae |
| 151 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 152 | 2849452216 | Gilliamella apicola AW11 | Isolate | Apidae |
| 153 | 2849455045 | Gilliamella apicola NO8 | Isolate | Apidae |
| 154 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 155 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 156 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 157 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 158 | 2868504459 | Gilliamella apis NO4 | Isolate | Apidae |
| 159 | 2870917785 | Gilliamella apis NO15 | Isolate | Apidae |
| 160 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 161 | 2873636219 | Gilliamella apicola App2-1 | Isolate | Apidae |
| 162 | 2876033458 | Gilliamella apicola AM6 | Isolate | Apidae |
| 163 | 2876036378 | Gilliamella apicola Choc3-5 | Isolate | Apidae |
| 164 | 2878462549 | Gilliamella apicola Occ3-1 | Isolate | Apidae |
| 165 | 2878464769 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 166 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 167 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 168 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 169 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 170 | 2958255616 | Serratia marcescens TM | Isolate | |
| 171 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 172 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 173 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 174 | 3300007766 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 4 gut | Metagenome | Drosophilidae |
| 175 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 176 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 177 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 178 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 179 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 180 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 181 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 182 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 183 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 184 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 185 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 186 | 2515154049 | Candidatus Gilliamella apicola wkB30 | Isolate | Apidae |
| 187 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 188 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 189 | 2585427711 | Candidatus Schmidhempelia bombi Bimp | Isolate | Apidae |
| 190 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 191 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 192 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 193 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 194 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 195 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 196 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 197 | 2854141978 | Gilliamella apicola A-12-12 | Isolate | Apidae |
| 198 | 2854147632 | Gilliamella apicola wkB195 | Isolate | Apidae |
| 199 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 200 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 201 | 2857878760 | Gilliamella apicola Gris1-4 | Isolate | Apidae |
| 202 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 203 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 204 | 2868489326 | Gilliamella apicola N10 | Isolate | Apidae |
| 205 | 2868499409 | Gilliamella apicola N-9-4 | Isolate | Apidae |
| 206 | 2870913170 | Gilliamella apis A-TSA2 | Isolate | Apidae |
| 207 | 2870920129 | Gilliamella apicola wkB108 | Isolate | Apidae |
| 208 | 2873633977 | Gilliamella apicola wkB178 | Isolate | Apidae |
| 209 | 2873638493 | Gilliamella apicola wkB72 | Isolate | Apidae |
| 210 | 2873651485 | Gilliamella apicola Choc4-2 | Isolate | Apidae |
| 211 | 2876025319 | Gilliamella apis NO12 | Isolate | Apidae |
| 212 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 213 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 214 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 215 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 216 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 217 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 218 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 219 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 220 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 221 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 222 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 223 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 224 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 225 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 226 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 227 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 228 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 229 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 230 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 231 | 8088493931 | Gilliamella apis K-MP18 | Isolate | Apidae |
| 232 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 233 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 234 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 235 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 236 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 237 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 238 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 239 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 240 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 241 | 2756170265 | Gilliamella apicola DSM 104097 | Isolate | Unclassified |
| 242 | 2834098943 | Gilliamella apis NO3 | Isolate | Apidae |
| 243 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 244 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 245 | 2843337836 | Gilliamella apicola N-12-12 | Isolate | Apidae |
| 246 | 2846480698 | Gilliamella apis N-G4 | Isolate | Apidae |
| 247 | 2846488152 | Gilliamella apicola Bim3-2 | Isolate | Apidae |
| 248 | 2849449383 | Gilliamella apicola WF3-4 | Isolate | Apidae |
| 249 | 2849458003 | Gilliamella apicola HK7 | Isolate | Apidae |
| 250 | 2849463436 | Gilliamella apicola A-8-12 | Isolate | Apidae |
| 251 | 2857876020 | Gilliamella apicola Nev6-6 | Isolate | Apidae |
| 252 | 2857881114 | Gilliamella apis N-G3 | Isolate | Apidae |
| 253 | 2868494745 | Gilliamella apis NO1 | Isolate | Apidae |
| 254 | 2870902796 | Gilliamella apicola GillExp13 | Isolate | Apidae |
| 255 | 2870915472 | Gilliamella apis A-TSA3 | Isolate | Apidae |
| 256 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 257 | 2873656248 | Gilliamella apicola A-1-24 | Isolate | Apidae |
| 258 | 2876016455 | Gilliamella apicola N6 | Isolate | Apidae |
| 259 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 260 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 261 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 262 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 263 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 264 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 265 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 266 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 267 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 268 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 269 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 270 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 271 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 272 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 273 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 274 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 275 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 276 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 277 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 278 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 279 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 280 | 8088486376 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 281 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 282 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 283 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 284 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 285 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 286 | 2515154034 | Frischella perrara PEB0191 | Isolate | Apidae |
| 287 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 288 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 289 | 2630968947 | Frischella perrara PEB0191 | Isolate | Apidae |
| 290 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 291 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 292 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 293 | 2785510744 | Gilliamella sp. ESL0405 | Isolate | Apidae |
| 294 | 2785510745 | Gilliamella sp. ESL0407 | Isolate | Apidae |
| 295 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 296 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 297 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 298 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 299 | 2843334863 | Gilliamella apicola A-2-24 | Isolate | Apidae |
| 300 | 2846490831 | Gilliamella apis ESL0172 | Isolate | Apidae |
| 301 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 302 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 303 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 304 | 2849446820 | Gilliamella apicola Bif1-4 | Isolate | Apidae |
| 305 | 2849468476 | Gilliamella apicola N-28 | Isolate | Apidae |
| 306 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 307 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 308 | 2854129949 | Gilliamella apis M1-2G | Isolate | Apidae |
| 309 | 2854137290 | Gilliamella apicola Imp1-6 | Isolate | Apidae |
| 310 | 2854139540 | Gilliamella apicola Imp1-1 | Isolate | Apidae |
| 311 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 312 | 2857883421 | Gilliamella apicola N2 | Isolate | Apidae |
| 313 | 2857891623 | Gilliamella apicola wkB171 | Isolate | Apidae |
| 314 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 315 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 316 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 317 | 2868486652 | Gilliamella sp. N-G2 | Isolate | Apidae |
| 318 | 2868506828 | Gilliamella apicola App4-10 | Isolate | Apidae |
| 319 | 2870897478 | Gilliamella apicola A-7-12 | Isolate | Apidae |
| 320 | 2870900452 | Gilliamella apis NO14 | Isolate | Apidae |
| 321 | 2873640908 | Gilliamella apicola wkB308 | Isolate | Apidae |
| 322 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 323 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 324 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 325 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 326 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 327 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 328 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 329 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 330 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 331 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 332 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 333 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 334 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 335 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 336 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 337 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 338 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 339 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 340 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 341 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 342 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 343 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 344 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 345 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 346 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 347 | 2515154048 | Candidatus Gilliamella apicola wkB11 | Isolate | Apidae |
| 348 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 349 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 350 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 351 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 352 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 353 | 2684622924 | Gilliamella apicola Ga_177 | Isolate | Unclassified |
| 354 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 355 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 356 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 357 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 358 | 2838840603 | Gilliamella apicola A-9-12 | Isolate | Apidae |
| 359 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 360 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 361 | 2846477985 | Gilliamella apicola Fer1-1 | Isolate | Apidae |
| 362 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 363 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 364 | 2849460838 | Gilliamella apicola Gris3-2 | Isolate | Apidae |
| 365 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 366 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 367 | 2854127928 | Gilliamella apicola Choc6-1 | Isolate | Apidae |
| 368 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 369 | 2857868033 | Gilliamella apis P62G | Isolate | Apidae |
| 370 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 371 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 372 | 2868497104 | Gilliamella apis A-TSA4 | Isolate | Apidae |
| 373 | 2870905362 | Gilliamella apicola Nev3-1 | Isolate | Apidae |
| 374 | 2873645950 | Gilliamella apicola Fer2-1 | Isolate | Apidae |
| 375 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 376 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 377 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 378 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 379 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 380 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 381 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 382 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 383 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 384 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 385 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 386 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 387 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 388 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 389 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 390 | 8088488961 | Gilliamella apis ESL0169 | Isolate | Apidae |
| 391 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 392 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562378_0067 | 3300056814 | Bacteria | 302707 |
| 2 | Ga0562378_0188 | 3300056814 | Bacteria | 151983 |
| 3 | Ga0160433_102121 | 3300012846 | Bacteria | 4524 |
| 4 | Ga0265387_1000214 | 3300024582 | Bacteria | 10141 |
| 5 | Ga0466724_02163 | 3300042649 | Bacteria | 15063 |
| 6 | Ga0466724_06778 | 3300042649 | Bacteria | 45367 |
| 7 | Ga0466724_31977 | 3300042649 | Unclassified | 1291 |
| 8 | Ga0466724_38034 | 3300042649 | Bacteria | 3180 |
| 9 | Ga0466725_391346 | 3300042654 | Bacteria | 12642 |
| 10 | gam1t_NODE_248298_length=35038_GC=33_7_Contigs=2 | 2189573031 | Bacteria | 35048 |
| 11 | HBC_ctgsDRAFT_1012542 | 3300000333 | Bacteria | 2033 |
| 12 | Ga0063521_1000956 | 3300003973 | Bacteria | 9393 |
| 13 | Ga0074303_1074651 | 3300005306 | Unclassified | 2092 |
| 14 | Ga0074278_122865 | 3300005721 | Bacteria | 27496 |
| 15 | Ga0102734_1002411 | 3300007129 | Bacteria | 4386 |
| 16 | Ga0104042_1035858 | 3300007130 | Bacteria | 1703 |
| 17 | Ga0466713_047172 | 3300042602 | Bacteria | 102974 |
| 18 | Ga0466697_008652 | 3300042611 | Bacteria | 2245 |
| 19 | Ga0466705_192436 | 3300042612 | Unclassified | 7116 |
| 20 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 21 | Ga0160433_101866 | 3300012846 | Bacteria | 5110 |
| 22 | Ga0247289_0288 | 3300035363 | Bacteria | 9186 |
| 23 | Ga0466730_048660 | 3300042625 | Bacteria | 2478 |
| 24 | Ga0466704_291603 | 3300042643 | Bacteria | 24945 |
| 25 | Ga0466724_06421 | 3300042649 | Bacteria | 6346 |
| 26 | Ga0466725_397958 | 3300042654 | Unclassified | 12483 |
| 27 | FGTW_contig00540 | 2065487013 | Bacteria | 3442 |
| 28 | FGTW_contig02308 | 2065487013 | Bacteria | 58123 |
| 29 | gam1t_NODE_551252_length=27406_GC=35_3_Contigs=10 | 2189573031 | Bacteria | 27496 |
| 30 | HBC_ctgsDRAFT_1001454 | 3300000333 | Bacteria | 5175 |
| 31 | SCG598L16_106705 | 3300000490 | Unclassified | 27442 |
| 32 | Meta3P_1000562 | 3300002464 | Bacteria | 50441 |
| 33 | CVPL010W_10016089 | 3300002931 | Bacteria | 6643 |
| 34 | Ga0063521_1000012 | 3300003973 | Bacteria | 168466 |
| 35 | Ga0074278_131980 | 3300005721 | Unclassified | 10926 |
| 36 | Ga0104049_1131857 | 3300007103 | Bacteria | 2051 |
| 37 | Ga0103264_1017001 | 3300007188 | Bacteria | 3561 |
| 38 | Ga0103268_1000644 | 3300007192 | Bacteria | 10100 |
| 39 | Ga0104147_1053003 | 3300007224 | Unclassified | 10069 |
| 40 | Ga0105003_1011373 | 3300007766 | Bacteria | 10047 |
| 41 | Ga0123356_10060454 | 3300010049 | Bacteria | 3536 |
| 42 | Ga0466701_007469 | 3300042598 | Bacteria | 67864 |
| 43 | Ga0466731_036213 | 3300042622 | Bacteria | 13986 |
| 44 | Ga0466730_025859 | 3300042625 | Bacteria | 2057 |
| 45 | Ga0466730_038238 | 3300042625 | Unclassified | 6420 |
| 46 | Ga0466730_054492 | 3300042625 | Unclassified | 1510 |
| 47 | Ga0466730_091724 | 3300042625 | Unclassified | 6025 |
| 48 | Ga0466703_117273 | 3300042636 | Bacteria | 5119 |
| 49 | DPOL_contig03408 | 2035918003 | Bacteria | 1172 |
| 50 | gam1t_NODE_401562_length=10926_GC=33_5_Contigs=1 | 2189573031 | Unclassified | 10926 |
| 51 | HBC_ctgsDRAFT_1027525 | 3300000333 | Bacteria | 1396 |
| 52 | SCG598I22_11105 | 3300000462 | Bacteria | 12951 |
| 53 | Ga0063521_1001110 | 3300003973 | Bacteria | 8224 |
| 54 | Ga0072941_1474138 | 3300005201 | Bacteria | 2589 |
| 55 | Ga0074188_1039579 | 3300005318 | Bacteria | 3963 |
| 56 | Ga0105005_1043123 | 3300007505 | Bacteria | 7650 |
| 57 | Ga0530661_002396 | 3300056564 | Bacteria | 7122 |
| 58 | Ga0466724_15447 | 3300042649 | Bacteria | 123877 |
| 59 | DPOL_contig19460 | 2035918003 | Bacteria | 14741 |
| 60 | FGTW_contig33108 | 2065487013 | Bacteria | 1889 |
| 61 | 2227646827 | 2225789004 | Bacteria | 43832 |
| 62 | HBC_ctgsDRAFT_1018821 | 3300000333 | Unclassified | 1683 |
| 63 | Ga0063521_1000034 | 3300003973 | Bacteria | 116714 |
| 64 | Ga0074302_1033037 | 3300005316 | Bacteria | 4075 |
| 65 | Ga0104041_1001551 | 3300007106 | Bacteria | 8199 |
| 66 | Ga0102740_1000822 | 3300007140 | Bacteria | 8429 |
| 67 | Ga0102737_1000134 | 3300007142 | Bacteria | 23678 |
| 68 | Ga0103264_1000020 | 3300007188 | Bacteria | 106161 |
| 69 | Ga0127645_110771 | 3300009461 | Bacteria | 20379 |
| 70 | Ga0466701_016393 | 3300042598 | Bacteria | 107739 |
| 71 | Ga0466707_300017 | 3300042601 | Bacteria | 65610 |
| 72 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 73 | Ga0265387_1000033 | 3300024582 | Bacteria | 52986 |
| 74 | Ga0247289_1586 | 3300035363 | Bacteria | 1973 |
| 75 | Ga0466731_246745 | 3300042622 | Unclassified | 2677 |
| 76 | Ga0466730_003038 | 3300042625 | Bacteria | 14273 |
| 77 | Ga0466724_38282 | 3300042649 | Bacteria | 53742 |
| 78 | Ga0466725_056204 | 3300042654 | Bacteria | 8858 |
| 79 | gam1t_NODE_355860_length=5669_GC=35_6_Contigs=1 | 2189573031 | Unclassified | 5669 |
| 80 | IMNBL1DRAFT_c0003502 | 3300000062 | Bacteria | 10045 |
| 81 | Ga0063521_1000011 | 3300003973 | Bacteria | 180817 |
| 82 | Ga0074278_130862 | 3300005721 | Bacteria | 1871 |
| 83 | Ga0074278_133893 | 3300005721 | Bacteria | 35048 |
| 84 | Ga0103266_1000288 | 3300007067 | Bacteria | 12558 |
| 85 | Ga0103261_1002893 | 3300007083 | Unclassified | 2681 |
| 86 | Ga0104042_1001236 | 3300007130 | Bacteria | 7347 |
| 87 | Ga0104040_1144830 | 3300007149 | Bacteria | 1691 |
| 88 | Ga0562377_0016 | 3300056842 | Bacteria | 1202354 |
| 89 | Ga0160436_1003460 | 3300012861 | Bacteria | 3872 |
| 90 | Ga0466730_012098 | 3300042625 | Bacteria | 1350 |
| 91 | Ga0466730_017562 | 3300042625 | Bacteria | 11835 |
| 92 | Ga0466730_042942 | 3300042625 | Bacteria | 14040 |
| 93 | Ga0466730_081137 | 3300042625 | Unclassified | 1108 |
| 94 | Ga0466724_07961 | 3300042649 | Bacteria | 121451 |
| 95 | Ga0466724_23937 | 3300042649 | Bacteria | 37568 |
| 96 | Ga0466724_41660 | 3300042649 | Bacteria | 2982 |
| 97 | CVPL010W_10016715 | 3300002931 | Bacteria | 4905 |
| 98 | CVPL010L_1000152 | 3300002932 | Bacteria | 19888 |
| 99 | Ga0063521_1000159 | 3300003973 | Bacteria | 50813 |
| 100 | Ga0074278_132911 | 3300005721 | Bacteria | 5669 |
| 101 | Ga0103264_1000311 | 3300007188 | Bacteria | 54659 |
| 102 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 103 | Ga0316159_10001 | 3300030930 | Bacteria | 1642808 |
| 104 | Ga0316159_11726 | 3300030930 | Bacteria | 2623 |
| 105 | Ga0466734_055956 | 3300042623 | Bacteria | 2699 |
| 106 | Ga0466730_012231 | 3300042625 | Unclassified | 4586 |
| 107 | Ga0466730_049305 | 3300042625 | Bacteria | 9301 |
| 108 | FGTW_contig33110 | 2065487013 | Unclassified | 1809 |
| 109 | Meta3P_1001162 | 3300002464 | Bacteria | 1599 |
| 110 | CVPL010W_10000175 | 3300002931 | Bacteria | 55645 |
| 111 | CVPL010W_10007624 | 3300002931 | Bacteria | 10557 |
| 112 | Ga0072941_1314165 | 3300005201 | Bacteria | 1872 |
| 113 | Ga0102736_1002909 | 3300007052 | Bacteria | 2603 |
| 114 | Ga0102737_1000788 | 3300007142 | Unclassified | 9783 |
| 115 | Ga0104040_1142556 | 3300007149 | Unclassified | 2635 |
| 116 | Ga0103268_1001237 | 3300007192 | Bacteria | 6535 |
| 117 | Ga0123357_10000131 | 3300009784 | Bacteria | 64937 |
| 118 | Ga0466707_193809 | 3300042601 | Bacteria | 2358 |
| 119 | Ga0466713_094090 | 3300042602 | Unclassified | 5402 |
| 120 | Ga0316159_10321 | 3300030930 | Bacteria | 8644 |
| 121 | Ga0466729_272234 | 3300042621 | Bacteria | 1417 |
| 122 | HBC_ctgsDRAFT_1008069 | 3300000333 | Bacteria | 2494 |
| 123 | Ga0102740_1000082 | 3300007140 | Bacteria | 22994 |
| 124 | Ga0104147_1107415 | 3300007224 | Bacteria | 3800 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.