Protein Family IF08844
Metagenome
Isolate
551
Members
173
Samples
470
Scaffolds
62.14
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_215242|Ga0466735_215242_1075_1290
- Length
- 71 aa
- Sequence
- LVKERENWTMAKKAKGSRVQVILECTEHKASGMPGTSRYITTKNRKNVTERLELKKYNPILRRVTVHKEIK
Sample Types
Isolate
14.7%
Metagenome
85.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
21.6%
Termitidae
19.8%
Unclassified
9.9%
Kalotermitidae
8.6%
Drosophilidae
5.6%
Formicidae
4.9%
Culicidae
3.7%
Elmidae
3.7%
Rhinotermitidae
3.7%
Armadillidiidae
3.7%
Passalidae
2.5%
Termopsidae
2.5%
Hydrophilidae
1.9%
Apidae
1.9%
Tenebrionidae
1.2%
Hodotermitidae
0.6%
Ectobiidae
0.6%
Pyroglyphidae
0.6%
Aphelinidae
0.6%
Cambaridae
0.6%
Bombycidae
0.6%
Monophlebidae
0.6%
Kiwaidae
0.6%
Taxonomy
Archaea
1
Bacteria
433
Eukaryota
0
Viruses
0
Unclassified
117
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 2 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 3 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 4 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 5 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 6 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 7 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 8 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 9 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 10 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 11 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 15 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 16 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 21 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 22 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 23 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 24 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 29 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 34 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 35 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 36 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 37 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 38 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 39 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 40 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 41 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 42 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 43 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 46 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 47 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 50 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 51 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 52 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 53 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 54 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 55 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 56 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 57 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 60 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 61 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 62 | 3300007058 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut | Metagenome | Drosophilidae |
| 63 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 64 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 65 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 66 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 67 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 68 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 69 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 70 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 71 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 72 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 73 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 74 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 75 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 76 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 77 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 78 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 79 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 80 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 81 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 82 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 83 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 84 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 85 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 86 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 87 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 88 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 89 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 90 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 91 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 92 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 93 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 94 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 95 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 96 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 97 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 98 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 99 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 100 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 101 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 102 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 103 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 104 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 105 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 106 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 107 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 108 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 109 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 110 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 111 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 112 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 113 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 114 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 115 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 116 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 117 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 118 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 119 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 120 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 121 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 122 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 123 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 124 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 125 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 126 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 127 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 128 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 129 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 130 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 131 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 132 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 133 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 134 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 135 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 136 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 137 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 138 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 139 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 140 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 141 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 142 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 143 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 144 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 145 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 146 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 147 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 148 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 149 | 3000153175 | Cardinium endosymbiont of Dermatophagoides farinae UMMZ BMOC 05-0812-001 | Isolate | Pyroglyphidae |
| 150 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 151 | 3300003131 | Encarsia pergandiella symbiont microbial communities from Weslaco, Texas | Metagenome | Aphelinidae |
| 152 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 153 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 154 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 155 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 156 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 157 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 158 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 159 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 160 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 161 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 162 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 163 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 164 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 165 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 166 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 167 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 168 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 169 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 170 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 171 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 172 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 173 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_079558 | 3300042656 | Unclassified | 1145 |
| 2 | Ga0466733_120374 | 3300042659 | Unclassified | 1131 |
| 3 | Ga0466701_074894 | 3300042598 | Bacteria | 11694 |
| 4 | Ga0466701_102144 | 3300042598 | Bacteria | 141929 |
| 5 | Ga0466706_152064 | 3300042599 | Bacteria | 39646 |
| 6 | Ga0466706_172897 | 3300042599 | Bacteria | 9027 |
| 7 | Ga0466700_173154 | 3300042600 | Bacteria | 5866 |
| 8 | Ga0466700_370987 | 3300042600 | Bacteria | 11024 |
| 9 | Ga0466707_064540 | 3300042601 | Bacteria | 6487 |
| 10 | Ga0466713_022356 | 3300042602 | Bacteria | 45305 |
| 11 | Ga0466713_062226 | 3300042602 | Bacteria | 23233 |
| 12 | Ga0466713_112154 | 3300042602 | Bacteria | 38459 |
| 13 | Ga0466716_284009 | 3300042605 | Bacteria | 2355 |
| 14 | Ga0466722_035623 | 3300042609 | Unclassified | 6725 |
| 15 | Ga0466722_042812 | 3300042609 | Bacteria | 110303 |
| 16 | Ga0466698_256438 | 3300042610 | Bacteria | 1166 |
| 17 | Ga0466697_056479 | 3300042611 | Unclassified | 1457 |
| 18 | Ga0160446_100002 | 3300012835 | Bacteria | 540874 |
| 19 | Ga0265387_1005299 | 3300024582 | Bacteria | 1744 |
| 20 | Ga0466657_311647 | 3300042582 | Unclassified | 3690 |
| 21 | Ga0466657_333412 | 3300042582 | Unclassified | 1749 |
| 22 | Ga0466690_022605 | 3300042590 | Bacteria | 13189 |
| 23 | Ga0466691_033758 | 3300042593 | Bacteria | 9008 |
| 24 | Ga0466691_227533 | 3300042593 | Bacteria | 16233 |
| 25 | Ga0466696_046481 | 3300042596 | Bacteria | 9675 |
| 26 | Ga0466696_445072 | 3300042596 | Unclassified | 2087 |
| 27 | Ga0466696_469541 | 3300042596 | Unclassified | 2460 |
| 28 | 2227061766 | 2225789003 | Unclassified | 745 |
| 29 | 2227246906 | 2225789004 | Bacteria | 1327 |
| 30 | 2227564381 | 2225789004 | Bacteria | 2686 |
| 31 | IMNBL1DRAFT_c0001371 | 3300000062 | Bacteria | 18314 |
| 32 | IMNBL1DRAFT_c0006017 | 3300000062 | Bacteria | 6764 |
| 33 | IMNBL1DRAFT_c0024516 | 3300000062 | Bacteria | 2337 |
| 34 | IMNBL1DRAFT_c0099179 | 3300000062 | Bacteria | 786 |
| 35 | JGI24698J34947_10020372 | 3300002449 | Bacteria | 3572 |
| 36 | JGI24702J35022_10001912 | 3300002462 | Bacteria | 12818 |
| 37 | JGI24702J35022_10909735 | 3300002462 | Unclassified | 548 |
| 38 | JGI24705J35276_12234799 | 3300002504 | Bacteria | 5861 |
| 39 | JGI24696J40584_12804568 | 3300002834 | Bacteria | 876 |
| 40 | CVPL010W_10000853 | 3300002931 | Bacteria | 34299 |
| 41 | Ga0068305_10048374 | 3300005083 | Bacteria | 9680 |
| 42 | Ga0068305_10210634 | 3300005083 | Unclassified | 730 |
| 43 | Ga0103261_1013596 | 3300007083 | Unclassified | 1130 |
| 44 | Ga0104019_1003000 | 3300007150 | Unclassified | 7827 |
| 45 | Ga0104050_1002642 | 3300007153 | Bacteria | 10238 |
| 46 | Ga0466710_056653 | 3300042613 | Bacteria | 1023 |
| 47 | Ga0466711_240969 | 3300042615 | Bacteria | 7232 |
| 48 | Ga0466715_012009 | 3300042616 | Unclassified | 6581 |
| 49 | Ga0466715_087433 | 3300042616 | Bacteria | 28443 |
| 50 | Ga0466715_567151 | 3300042616 | Bacteria | 35252 |
| 51 | Ga0466723_160676 | 3300042618 | Bacteria | 9124 |
| 52 | Ga0466726_041856 | 3300042619 | Bacteria | 4291 |
| 53 | Ga0466726_284059 | 3300042619 | Bacteria | 1138 |
| 54 | Ga0123357_10026818 | 3300009784 | Bacteria | 7783 |
| 55 | Ga0123356_11826328 | 3300010049 | Bacteria | 756 |
| 56 | Ga0123353_10038790 | 3300010167 | Bacteria | 7490 |
| 57 | Ga0123353_10298053 | 3300010167 | Unclassified | 2463 |
| 58 | Ga0123353_11632104 | 3300010167 | Unclassified | 812 |
| 59 | Ga0123354_10159018 | 3300010882 | Bacteria | 2693 |
| 60 | Ga0466734_043808 | 3300042623 | Unclassified | 2643 |
| 61 | Ga0466735_053776 | 3300042624 | Unclassified | 1060 |
| 62 | Ga0466735_130984 | 3300042624 | Bacteria | 4143 |
| 63 | Ga0466730_103184 | 3300042625 | Bacteria | 430539 |
| 64 | Ga0466704_038771 | 3300042643 | Unclassified | 3761 |
| 65 | Ga0466704_449548 | 3300042643 | Unclassified | 16502 |
| 66 | Ga0466724_10112 | 3300042649 | Unclassified | 1045 |
| 67 | Ga0466724_30447 | 3300042649 | Bacteria | 1179 |
| 68 | Ga0466727_142569 | 3300042655 | Unclassified | 1016 |
| 69 | Ga0466727_218918 | 3300042655 | Bacteria | 13170 |
| 70 | Ga0466697_159733 | 3300042611 | Bacteria | 2470 |
| 71 | Ga0466705_017856 | 3300042612 | Bacteria | 8827 |
| 72 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 73 | Ga0466706_099033 | 3300042599 | Bacteria | 37493 |
| 74 | Ga0466707_345434 | 3300042601 | Bacteria | 28806 |
| 75 | Ga0466707_391768 | 3300042601 | Bacteria | 24182 |
| 76 | Ga0466713_016116 | 3300042602 | Bacteria | 46967 |
| 77 | Ga0466713_060328 | 3300042602 | Bacteria | 119085 |
| 78 | Ga0466713_075369 | 3300042602 | Unclassified | 1473 |
| 79 | Ga0466713_081632 | 3300042602 | Bacteria | 8129 |
| 80 | Ga0466713_105116 | 3300042602 | Unclassified | 14343 |
| 81 | Ga0466722_216384 | 3300042609 | Bacteria | 4635 |
| 82 | Ga0466698_510379 | 3300042610 | Unclassified | 3482 |
| 83 | Ga0160467_100499 | 3300012829 | Unclassified | 37617 |
| 84 | Ga0466657_184694 | 3300042582 | Unclassified | 1091 |
| 85 | Ga0466690_310836 | 3300042590 | Unclassified | 8470 |
| 86 | Ga0466690_372162 | 3300042590 | Bacteria | 16481 |
| 87 | Ga0466692_053741 | 3300042591 | Unclassified | 2165 |
| 88 | Ga0466692_063808 | 3300042591 | Bacteria | 6328 |
| 89 | Ga0466694_394527 | 3300042594 | Unclassified | 1444 |
| 90 | Ga0466695_384124 | 3300042595 | Bacteria | 90029 |
| 91 | 2226983150 | 2225789003 | Bacteria | 9093 |
| 92 | 2227195816 | 2225789004 | Bacteria | 1452 |
| 93 | IMNBL1DRAFT_c0061828 | 3300000062 | Bacteria | 1121 |
| 94 | IMNBL1DRAFT_c0069760 | 3300000062 | Bacteria | 1019 |
| 95 | IMNBL1DRAFT_c0116438 | 3300000062 | Unclassified | 706 |
| 96 | JGI24702J35022_10238537 | 3300002462 | Unclassified | 1054 |
| 97 | Ga0052165_100037 | 3300003131 | Bacteria | 11772 |
| 98 | Ga0068302_10095337 | 3300005071 | Bacteria | 6024 |
| 99 | Ga0068305_10003844 | 3300005083 | Bacteria | 80352 |
| 100 | Ga0104041_1131456 | 3300007106 | Bacteria | 714 |
| 101 | Ga0102734_1006437 | 3300007129 | Bacteria | 2631 |
| 102 | Ga0466710_216749 | 3300042613 | Bacteria | 1164 |
| 103 | Ga0466710_217164 | 3300042613 | Bacteria | 1113 |
| 104 | Ga0466711_093803 | 3300042615 | Bacteria | 25402 |
| 105 | Ga0466711_176920 | 3300042615 | Bacteria | 1632 |
| 106 | Ga0466711_251542 | 3300042615 | Bacteria | 12436 |
| 107 | Ga0466711_457629 | 3300042615 | Unclassified | 3492 |
| 108 | Ga0466723_018026 | 3300042618 | Bacteria | 7658 |
| 109 | Ga0466723_101177 | 3300042618 | Bacteria | 3648 |
| 110 | Ga0123357_10048094 | 3300009784 | Unclassified | 5781 |
| 111 | Ga0123356_11259665 | 3300010049 | Bacteria | 904 |
| 112 | Ga0123354_10017301 | 3300010882 | Bacteria | 11293 |
| 113 | Ga0466734_127822 | 3300042623 | Unclassified | 1465 |
| 114 | Ga0466735_078843 | 3300042624 | Unclassified | 2198 |
| 115 | Ga0466735_082654 | 3300042624 | Unclassified | 1203 |
| 116 | Ga0466704_170981 | 3300042643 | Bacteria | 2385 |
| 117 | Ga0466704_205695 | 3300042643 | Bacteria | 8224 |
| 118 | Ga0466704_457279 | 3300042643 | Bacteria | 1138 |
| 119 | Ga0466704_605489 | 3300042643 | Bacteria | 25005 |
| 120 | Ga0466709_325926 | 3300042648 | Bacteria | 6862 |
| 121 | Ga0466725_040041 | 3300042654 | Bacteria | 2426 |
| 122 | Ga0466727_304196 | 3300042655 | Unclassified | 3116 |
| 123 | Ga0466733_161706 | 3300042659 | Bacteria | 1356 |
| 124 | Ga0466701_022679 | 3300042598 | Bacteria | 29742 |
| 125 | Ga0466706_089813 | 3300042599 | Bacteria | 54811 |
| 126 | Ga0466706_147059 | 3300042599 | Bacteria | 2729 |
| 127 | Ga0466707_234770 | 3300042601 | Bacteria | 11125 |
| 128 | Ga0466707_373967 | 3300042601 | Bacteria | 1337 |
| 129 | Ga0466713_070006 | 3300042602 | Bacteria | 89523 |
| 130 | Ga0466713_082426 | 3300042602 | Bacteria | 104514 |
| 131 | Ga0466714_086088 | 3300042603 | Bacteria | 35685 |
| 132 | Ga0466714_088011 | 3300042603 | Bacteria | 41067 |
| 133 | Ga0466719_053145 | 3300042606 | Bacteria | 15783 |
| 134 | Ga0466719_273967 | 3300042606 | Bacteria | 1029 |
| 135 | Ga0466722_044304 | 3300042609 | Bacteria | 15633 |
| 136 | Ga0466722_186775 | 3300042609 | Unclassified | 6474 |
| 137 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 138 | Ga0466657_075594 | 3300042582 | Bacteria | 1787 |
| 139 | Ga0466692_201931 | 3300042591 | Bacteria | 20461 |
| 140 | Ga0466691_019050 | 3300042593 | Bacteria | 28586 |
| 141 | Ga0466691_038604 | 3300042593 | Bacteria | 1021 |
| 142 | Ga0466691_149521 | 3300042593 | Unclassified | 8261 |
| 143 | Ga0466694_259237 | 3300042594 | Bacteria | 1919 |
| 144 | Ga0466695_274982 | 3300042595 | Bacteria | 2416 |
| 145 | Ga0466695_356052 | 3300042595 | Unclassified | 2067 |
| 146 | Ga0466696_108117 | 3300042596 | Bacteria | 10496 |
| 147 | Ga0466696_503453 | 3300042596 | Bacteria | 10294 |
| 148 | 2227247777 | 2225789004 | Bacteria | 1325 |
| 149 | 2227492405 | 2225789004 | Bacteria | 783 |
| 150 | IMNBL1DRAFT_c0163124 | 3300000062 | Bacteria | 568 |
| 151 | HBC_ctgsDRAFT_1003660 | 3300000333 | Bacteria | 3528 |
| 152 | JGI24702J35022_10104098 | 3300002462 | Bacteria | 1556 |
| 153 | JGI24702J35022_10296092 | 3300002462 | Bacteria | 954 |
| 154 | JGI24702J35022_10312081 | 3300002462 | Unclassified | 931 |
| 155 | JGI24705J35276_12232663 | 3300002504 | Bacteria | 4436 |
| 156 | Ga0068302_10707389 | 3300005071 | Bacteria | 574 |
| 157 | Ga0068305_10241857 | 3300005083 | Unclassified | 2273 |
| 158 | Ga0068305_10390049 | 3300005083 | Unclassified | 981 |
| 159 | Ga0074302_1157278 | 3300005316 | Bacteria | 689 |
| 160 | Ga0102735_1002408 | 3300007080 | Bacteria | 2852 |
| 161 | Ga0103267_1000239 | 3300007190 | Bacteria | 43613 |
| 162 | Ga0103268_1000516 | 3300007192 | Bacteria | 11590 |
| 163 | Ga0123357_10003076 | 3300009784 | Bacteria | 18929 |
| 164 | Ga0466711_093410 | 3300042615 | Bacteria | 55362 |
| 165 | Ga0466715_063479 | 3300042616 | Bacteria | 6772 |
| 166 | Ga0466715_197940 | 3300042616 | Bacteria | 8128 |
| 167 | Ga0466726_096515 | 3300042619 | Bacteria | 2487 |
| 168 | Ga0466726_238478 | 3300042619 | Bacteria | 6103 |
| 169 | Ga0466726_245063 | 3300042619 | Bacteria | 1005 |
| 170 | Ga0466729_190196 | 3300042621 | Bacteria | 9799 |
| 171 | Ga0123357_10004344 | 3300009784 | Bacteria | 16614 |
| 172 | Ga0123355_11156292 | 3300009826 | Unclassified | 796 |
| 173 | Ga0123356_10113985 | 3300010049 | Bacteria | 2616 |
| 174 | Ga0123353_10695624 | 3300010167 | Bacteria | 1428 |
| 175 | Ga0123353_11286436 | 3300010167 | Unclassified | 951 |
| 176 | Ga0123353_11821054 | 3300010167 | Bacteria | 755 |
| 177 | Ga0123354_10035043 | 3300010882 | Bacteria | 7840 |
| 178 | Ga0466735_004173 | 3300042624 | Bacteria | 12455 |
| 179 | Ga0466735_006320 | 3300042624 | Bacteria | 4033 |
| 180 | Ga0466735_148854 | 3300042624 | Unclassified | 3256 |
| 181 | Ga0466730_040791 | 3300042625 | Unclassified | 1075 |
| 182 | Ga0466730_095520 | 3300042625 | Unclassified | 1223 |
| 183 | Ga0466703_204989 | 3300042636 | Bacteria | 5033 |
| 184 | Ga0466703_378391 | 3300042636 | Bacteria | 22609 |
| 185 | Ga0466704_025190 | 3300042643 | Bacteria | 1286 |
| 186 | Ga0466704_031821 | 3300042643 | Bacteria | 5181 |
| 187 | Ga0466704_444820 | 3300042643 | Bacteria | 2401 |
| 188 | Ga0466705_041615 | 3300042612 | Bacteria | 11319 |
| 189 | Ga0466733_022324 | 3300042659 | Unclassified | 1150 |
| 190 | Ga0466700_274743 | 3300042600 | Bacteria | 43717 |
| 191 | Ga0466707_135468 | 3300042601 | Bacteria | 1051 |
| 192 | Ga0466713_015196 | 3300042602 | Bacteria | 51519 |
| 193 | Ga0466713_094038 | 3300042602 | Bacteria | 3678 |
| 194 | Ga0466713_115233 | 3300042602 | Bacteria | 28611 |
| 195 | Ga0466713_145554 | 3300042602 | Bacteria | 3657 |
| 196 | Ga0466714_003866 | 3300042603 | Bacteria | 5731 |
| 197 | Ga0466721_033835 | 3300042608 | Bacteria | 1009 |
| 198 | Ga0466722_012198 | 3300042609 | Unclassified | 5142 |
| 199 | Ga0466722_062829 | 3300042609 | Bacteria | 60409 |
| 200 | Ga0160443_100026 | 3300012848 | Bacteria | 373861 |
| 201 | Ga0157631_127760 | 3300013007 | Bacteria | 1503 |
| 202 | Ga0466692_034023 | 3300042591 | Bacteria | 35790 |
| 203 | Ga0466692_072441 | 3300042591 | Bacteria | 27116 |
| 204 | Ga0466691_221333 | 3300042593 | Unclassified | 1033 |
| 205 | IMNBGM34_c000149 | 3300000036 | Bacteria | 20599 |
| 206 | IMNBL1DRAFT_c0084189 | 3300000062 | Bacteria | 885 |
| 207 | IMNBL1DRAFT_c0148593 | 3300000062 | Unclassified | 602 |
| 208 | JGI24702J35022_10035894 | 3300002462 | Bacteria | 2650 |
| 209 | JGI24702J35022_10132428 | 3300002462 | Unclassified | 1385 |
| 210 | JGI24702J35022_10356624 | 3300002462 | Unclassified | 875 |
| 211 | JGI24705J35276_12132739 | 3300002504 | Bacteria | 1110 |
| 212 | JGI24699J35502_11133324 | 3300002509 | Bacteria | 9856 |
| 213 | JGI24699J35502_11134203 | 3300002509 | Bacteria | 55646 |
| 214 | JGI24696J40584_12814655 | 3300002834 | Bacteria | 895 |
| 215 | JGI24696J40584_12959771 | 3300002834 | Bacteria | 5614 |
| 216 | Ga0068305_10024234 | 3300005083 | Bacteria | 767 |
| 217 | Ga0072941_1015407 | 3300005201 | Bacteria | 4683 |
| 218 | Ga0104045_1090704 | 3300007085 | Bacteria | 670 |
| 219 | Ga0104048_1179961 | 3300007143 | Unclassified | 821 |
| 220 | Ga0103267_1000397 | 3300007190 | Bacteria | 14379 |
| 221 | Ga0103268_1017826 | 3300007192 | Unclassified | 1573 |
| 222 | Ga0466711_408610 | 3300042615 | Bacteria | 17675 |
| 223 | Ga0466723_137868 | 3300042618 | Bacteria | 7658 |
| 224 | Ga0466723_249141 | 3300042618 | Bacteria | 8106 |
| 225 | Ga0466726_081325 | 3300042619 | Bacteria | 12183 |
| 226 | Ga0466728_251123 | 3300042620 | Bacteria | 15910 |
| 227 | Ga0466729_172677 | 3300042621 | Unclassified | 1493 |
| 228 | Ga0123355_10056099 | 3300009826 | Bacteria | 6377 |
| 229 | Ga0123356_11277182 | 3300010049 | Bacteria | 898 |
| 230 | Ga0123356_11574103 | 3300010049 | Unclassified | 813 |
| 231 | Ga0123353_13442775 | 3300010167 | Bacteria | 501 |
| 232 | Ga0123354_10610285 | 3300010882 | Bacteria | 795 |
| 233 | Ga0466734_029098 | 3300042623 | Bacteria | 4301 |
| 234 | Ga0466735_124177 | 3300042624 | Bacteria | 1740 |
| 235 | Ga0466730_066071 | 3300042625 | Unclassified | 1249 |
| 236 | Ga0466730_097984 | 3300042625 | Bacteria | 727286 |
| 237 | Ga0466703_002363 | 3300042636 | Bacteria | 11775 |
| 238 | Ga0466703_075868 | 3300042636 | Bacteria | 1733 |
| 239 | Ga0466703_103576 | 3300042636 | Unclassified | 2315 |
| 240 | Ga0466703_188255 | 3300042636 | Bacteria | 5690 |
| 241 | Ga0466703_394153 | 3300042636 | Bacteria | 8228 |
| 242 | Ga0466704_370398 | 3300042643 | Bacteria | 9453 |
| 243 | Ga0466724_43696 | 3300042649 | Bacteria | 561295 |
| 244 | Ga0466727_029173 | 3300042655 | Bacteria | 13502 |
| 245 | Ga0466727_031538 | 3300042655 | Bacteria | 3979 |
| 246 | Ga0466727_057990 | 3300042655 | Bacteria | 10301 |
| 247 | Ga0466727_150546 | 3300042655 | Bacteria | 2047 |
| 248 | Ga0466727_275590 | 3300042655 | Unclassified | 2001 |
| 249 | Ga0466705_019787 | 3300042612 | Bacteria | 48611 |
| 250 | Ga0466705_277955 | 3300042612 | Bacteria | 13235 |
| 251 | Ga0466701_075520 | 3300042598 | Bacteria | 1088 |
| 252 | Ga0466706_072948 | 3300042599 | Bacteria | 1486 |
| 253 | Ga0466707_053432 | 3300042601 | Bacteria | 2481 |
| 254 | Ga0466707_194915 | 3300042601 | Bacteria | 10556 |
| 255 | Ga0466707_316673 | 3300042601 | Bacteria | 3677 |
| 256 | Ga0466713_046765 | 3300042602 | Unclassified | 1436 |
| 257 | Ga0466713_116907 | 3300042602 | Bacteria | 9404 |
| 258 | Ga0466716_274622 | 3300042605 | Bacteria | 1319 |
| 259 | Ga0466719_102024 | 3300042606 | Bacteria | 10936 |
| 260 | Ga0466719_159764 | 3300042606 | Bacteria | 3992 |
| 261 | Ga0466722_080116 | 3300042609 | Bacteria | 2571 |
| 262 | Ga0466722_149354 | 3300042609 | Bacteria | 5741 |
| 263 | Ga0466722_216178 | 3300042609 | Bacteria | 13028 |
| 264 | Ga0415639_232662 | 3300038395 | Unclassified | 1294 |
| 265 | Ga0466656_178247 | 3300042550 | Bacteria | 1016 |
| 266 | Ga0466657_248951 | 3300042582 | Unclassified | 1299 |
| 267 | Ga0466690_017303 | 3300042590 | Unclassified | 4373 |
| 268 | Ga0466690_124251 | 3300042590 | Bacteria | 8184 |
| 269 | Ga0466691_089972 | 3300042593 | Bacteria | 7881 |
| 270 | Ga0466696_317782 | 3300042596 | Bacteria | 3141 |
| 271 | Ga0466701_007914 | 3300042598 | Bacteria | 29857 |
| 272 | 2227113606 | 2225789004 | Unclassified | 1732 |
| 273 | 2227540478 | 2225789004 | Bacteria | 2997 |
| 274 | IMNBL1DRAFT_c0065173 | 3300000062 | Bacteria | 1075 |
| 275 | JGI24698J34947_10078585 | 3300002449 | Bacteria | 1556 |
| 276 | JGI24702J35022_10002417 | 3300002462 | Bacteria | 11409 |
| 277 | JGI24702J35022_10354993 | 3300002462 | Unclassified | 877 |
| 278 | JGI24696J40584_12343295 | 3300002834 | Bacteria | 533 |
| 279 | JGI24696J40584_12953521 | 3300002834 | Bacteria | 2496 |
| 280 | Ga0103265_1031541 | 3300007068 | Unclassified | 1309 |
| 281 | Ga0104050_1032774 | 3300007153 | Unclassified | 3883 |
| 282 | Ga0466710_180112 | 3300042613 | Bacteria | 2120 |
| 283 | Ga0466711_148227 | 3300042615 | Bacteria | 5486 |
| 284 | Ga0466711_317387 | 3300042615 | Bacteria | 16053 |
| 285 | Ga0466715_165527 | 3300042616 | Bacteria | 17862 |
| 286 | Ga0466723_068280 | 3300042618 | Bacteria | 19935 |
| 287 | Ga0466726_003419 | 3300042619 | Bacteria | 66294 |
| 288 | Ga0466728_083421 | 3300042620 | Bacteria | 11232 |
| 289 | Ga0466728_139318 | 3300042620 | Bacteria | 53765 |
| 290 | Ga0466728_440646 | 3300042620 | Unclassified | 1873 |
| 291 | Ga0123357_10044939 | 3300009784 | Bacteria | 5994 |
| 292 | Ga0123357_10312432 | 3300009784 | Bacteria | 1567 |
| 293 | Ga0123356_11949860 | 3300010049 | Unclassified | 732 |
| 294 | Ga0123356_12248214 | 3300010049 | Unclassified | 682 |
| 295 | Ga0123356_13925589 | 3300010049 | Unclassified | 513 |
| 296 | Ga0123353_10169091 | 3300010167 | Bacteria | 3472 |
| 297 | Ga0123353_11463890 | 3300010167 | Bacteria | 873 |
| 298 | Ga0123353_12421875 | 3300010167 | Unclassified | 627 |
| 299 | Ga0123353_12881905 | 3300010167 | Unclassified | 561 |
| 300 | Ga0123354_10000641 | 3300010882 | Bacteria | 36828 |
| 301 | Ga0466729_309431 | 3300042621 | Bacteria | 11898 |
| 302 | Ga0466704_081984 | 3300042643 | Bacteria | 15027 |
| 303 | Ga0466704_549519 | 3300042643 | Bacteria | 2382 |
| 304 | Ga0466708_075006 | 3300042652 | Bacteria | 19405 |
| 305 | Ga0466697_069760 | 3300042611 | Bacteria | 1613 |
| 306 | Ga0466697_110320 | 3300042611 | Bacteria | 1378 |
| 307 | Ga0466697_159554 | 3300042611 | Bacteria | 1080 |
| 308 | Ga0466733_045911 | 3300042659 | Bacteria | 5727 |
| 309 | Ga0466706_108051 | 3300042599 | Bacteria | 14033 |
| 310 | Ga0466713_114568 | 3300042602 | Bacteria | 10441 |
| 311 | Ga0160431_118025 | 3300012828 | Unclassified | 753 |
| 312 | Ga0466656_188267 | 3300042550 | Bacteria | 3967 |
| 313 | Ga0466690_023633 | 3300042590 | Unclassified | 5241 |
| 314 | Ga0466690_179758 | 3300042590 | Bacteria | 5711 |
| 315 | Ga0466692_109685 | 3300042591 | Bacteria | 126606 |
| 316 | Ga0466695_122567 | 3300042595 | Bacteria | 3640 |
| 317 | Ga0466696_110416 | 3300042596 | Bacteria | 1471 |
| 318 | Ga0466696_172161 | 3300042596 | Unclassified | 1035 |
| 319 | IMNBGM34_c006868 | 3300000036 | Bacteria | 1470 |
| 320 | IMNBL1DRAFT_c0000734 | 3300000062 | Bacteria | 25991 |
| 321 | IMNBL1DRAFT_c0058027 | 3300000062 | Bacteria | 1178 |
| 322 | IMNBL1DRAFT_c0065555 | 3300000062 | Unclassified | 1070 |
| 323 | JGI24695J34938_10035803 | 3300002450 | Bacteria | 2267 |
| 324 | JGI24702J35022_10090557 | 3300002462 | Bacteria | 1664 |
| 325 | JGI24696J40584_12671853 | 3300002834 | Bacteria | 711 |
| 326 | JGI24696J40584_12756721 | 3300002834 | Bacteria | 802 |
| 327 | Ga0068302_10090017 | 3300005071 | Bacteria | 3108 |
| 328 | Ga0068305_10017541 | 3300005083 | Bacteria | 7947 |
| 329 | Ga0068305_10051546 | 3300005083 | Bacteria | 11589 |
| 330 | Ga0104045_1026129 | 3300007085 | Bacteria | 7628 |
| 331 | Ga0103267_1000100 | 3300007190 | Bacteria | 31906 |
| 332 | Ga0103267_1013618 | 3300007190 | Bacteria | 2553 |
| 333 | Ga0466710_029113 | 3300042613 | Bacteria | 1017 |
| 334 | Ga0466715_201135 | 3300042616 | Bacteria | 14603 |
| 335 | Ga0466715_276657 | 3300042616 | Unclassified | 3397 |
| 336 | Ga0123357_10090032 | 3300009784 | Unclassified | 4004 |
| 337 | Ga0123357_10429427 | 3300009784 | Bacteria | 1169 |
| 338 | Ga0466731_084116 | 3300042622 | Bacteria | 3312 |
| 339 | Ga0466735_056251 | 3300042624 | Bacteria | 13449 |
| 340 | Ga0466735_203546 | 3300042624 | Bacteria | 2788 |
| 341 | Ga0466703_338372 | 3300042636 | Bacteria | 3808 |
| 342 | Ga0466703_359395 | 3300042636 | Bacteria | 13580 |
| 343 | Ga0466703_411180 | 3300042636 | Unclassified | 1161 |
| 344 | Ga0466704_533114 | 3300042643 | Bacteria | 6606 |
| 345 | Ga0466708_125692 | 3300042652 | Unclassified | 1416 |
| 346 | Ga0466708_183370 | 3300042652 | Bacteria | 8267 |
| 347 | Ga0466725_311188 | 3300042654 | Bacteria | 11217 |
| 348 | Ga0466697_162855 | 3300042611 | Unclassified | 1026 |
| 349 | Ga0466733_142535 | 3300042659 | Bacteria | 25179 |
| 350 | Ga0466706_028065 | 3300042599 | Bacteria | 73562 |
| 351 | Ga0466706_163273 | 3300042599 | Bacteria | 1076 |
| 352 | Ga0466706_263539 | 3300042599 | Bacteria | 23400 |
| 353 | Ga0466707_176219 | 3300042601 | Unclassified | 1082 |
| 354 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 355 | Ga0466713_103938 | 3300042602 | Bacteria | 2628 |
| 356 | Ga0466719_043210 | 3300042606 | Bacteria | 5393 |
| 357 | Ga0466720_108080 | 3300042607 | Unclassified | 1127 |
| 358 | Ga0466698_225151 | 3300042610 | Bacteria | 1459 |
| 359 | Ga0466697_011818 | 3300042611 | Bacteria | 1120 |
| 360 | Ga0160467_100249 | 3300012829 | Bacteria | 66389 |
| 361 | Ga0160455_100265 | 3300012837 | Bacteria | 38513 |
| 362 | Ga0160445_100249 | 3300012847 | Bacteria | 38513 |
| 363 | Ga0160457_1022666 | 3300012858 | Bacteria | 878 |
| 364 | Ga0466692_015734 | 3300042591 | Unclassified | 5116 |
| 365 | Ga0466692_180140 | 3300042591 | Unclassified | 2552 |
| 366 | IMNBGM34_c049006 | 3300000036 | Bacteria | 554 |
| 367 | IMNBL1DRAFT_c0000896 | 3300000062 | Bacteria | 23113 |
| 368 | IMNBL1DRAFT_c0002818 | 3300000062 | Bacteria | 11728 |
| 369 | JGI24702J35022_10717437 | 3300002462 | Bacteria | 622 |
| 370 | Meta3P_1004777 | 3300002464 | Unclassified | 12317 |
| 371 | Ga0068302_10096508 | 3300005071 | Bacteria | 3473 |
| 372 | Ga0068302_10202761 | 3300005071 | Bacteria | 2987 |
| 373 | Ga0068305_10091888 | 3300005083 | Bacteria | 522 |
| 374 | Ga0068305_10130315 | 3300005083 | Unclassified | 5626 |
| 375 | Ga0068305_10138885 | 3300005083 | Unclassified | 1544 |
| 376 | Ga0068305_10369833 | 3300005083 | Unclassified | 575 |
| 377 | Ga0074306_1119707 | 3300005309 | Unclassified | 1326 |
| 378 | Ga0104043_1102530 | 3300007058 | Bacteria | 566 |
| 379 | Ga0466715_203344 | 3300042616 | Bacteria | 4019 |
| 380 | Ga0466715_448848 | 3300042616 | Bacteria | 13742 |
| 381 | Ga0466715_500162 | 3300042616 | Bacteria | 8686 |
| 382 | Ga0466718_123648 | 3300042617 | Bacteria | 1006 |
| 383 | Ga0123357_10177221 | 3300009784 | Bacteria | 2502 |
| 384 | Ga0123355_11205625 | 3300009826 | Unclassified | 772 |
| 385 | Ga0123356_10337166 | 3300010049 | Bacteria | 1627 |
| 386 | Ga0123356_10932612 | 3300010049 | Unclassified | 1039 |
| 387 | Ga0123356_11516151 | 3300010049 | Bacteria | 828 |
| 388 | Ga0123353_10620337 | 3300010167 | Unclassified | 1540 |
| 389 | Ga0123353_12330964 | 3300010167 | Unclassified | 643 |
| 390 | Ga0466729_211490 | 3300042621 | Archaea | 3254 |
| 391 | Ga0466731_045974 | 3300042622 | Bacteria | 1654 |
| 392 | Ga0466735_030003 | 3300042624 | Bacteria | 1685 |
| 393 | Ga0466735_176716 | 3300042624 | Unclassified | 1030 |
| 394 | Ga0466735_215242 | 3300042624 | Bacteria | 2847 |
| 395 | Ga0466735_227414 | 3300042624 | Bacteria | 1115 |
| 396 | Ga0466703_000011 | 3300042636 | Unclassified | 1933 |
| 397 | Ga0466703_008945 | 3300042636 | Bacteria | 15665 |
| 398 | Ga0466709_109549 | 3300042648 | Bacteria | 2364 |
| 399 | Ga0466708_210818 | 3300042652 | Bacteria | 4597 |
| 400 | Ga0466708_349638 | 3300042652 | Bacteria | 47516 |
| 401 | Ga0466697_077754 | 3300042611 | Bacteria | 1113 |
| 402 | Ga0466705_148423 | 3300042612 | Unclassified | 3469 |
| 403 | Ga0466732_215433 | 3300042656 | Unclassified | 2191 |
| 404 | Ga0466733_133816 | 3300042659 | Unclassified | 1375 |
| 405 | Ga0466733_181508 | 3300042659 | Bacteria | 11920 |
| 406 | Ga0466701_058861 | 3300042598 | Bacteria | 109799 |
| 407 | Ga0466707_088230 | 3300042601 | Bacteria | 4596 |
| 408 | Ga0466707_285135 | 3300042601 | Unclassified | 1680 |
| 409 | Ga0466713_004309 | 3300042602 | Bacteria | 4253 |
| 410 | Ga0466713_062719 | 3300042602 | Bacteria | 59430 |
| 411 | Ga0466714_006170 | 3300042603 | Bacteria | 1468 |
| 412 | Ga0466714_094553 | 3300042603 | Bacteria | 52205 |
| 413 | Ga0466716_437045 | 3300042605 | Bacteria | 3818 |
| 414 | Ga0466719_216933 | 3300042606 | Bacteria | 4391 |
| 415 | Ga0466719_434603 | 3300042606 | Bacteria | 3443 |
| 416 | Ga0466719_492925 | 3300042606 | Bacteria | 13831 |
| 417 | Ga0466722_102197 | 3300042609 | Unclassified | 7023 |
| 418 | Ga0466722_122079 | 3300042609 | Bacteria | 3787 |
| 419 | Ga0466722_235301 | 3300042609 | Bacteria | 14337 |
| 420 | Ga0466698_212926 | 3300042610 | Bacteria | 1433 |
| 421 | Ga0160468_100046 | 3300012819 | Bacteria | 188813 |
| 422 | Ga0160468_107030 | 3300012819 | Unclassified | 1193 |
| 423 | Ga0160445_102576 | 3300012847 | Unclassified | 4092 |
| 424 | Ga0160445_111664 | 3300012847 | Unclassified | 1273 |
| 425 | Ga0265387_1044838 | 3300024582 | Unclassified | 773 |
| 426 | Ga0466692_008426 | 3300042591 | Bacteria | 17745 |
| 427 | Ga0466694_225731 | 3300042594 | Bacteria | 3614 |
| 428 | Ga0466696_104293 | 3300042596 | Bacteria | 5688 |
| 429 | Ga0466696_339714 | 3300042596 | Unclassified | 2073 |
| 430 | 2227361377 | 2225789004 | Bacteria | 6087 |
| 431 | IMNBL1DRAFT_c0024888 | 3300000062 | Bacteria | 2306 |
| 432 | IMNBL1DRAFT_c0033924 | 3300000062 | Bacteria | 1823 |
| 433 | IMNBL1DRAFT_c0085311 | 3300000062 | Unclassified | 877 |
| 434 | JGI24702J35022_10000410 | 3300002462 | Bacteria | 25605 |
| 435 | JGI24702J35022_10179008 | 3300002462 | Bacteria | 1203 |
| 436 | JGI24705J35276_11623449 | 3300002504 | Unclassified | 600 |
| 437 | JGI24705J35276_12195525 | 3300002504 | Bacteria | 1526 |
| 438 | JGI24705J35276_12238563 | 3300002504 | Bacteria | 26858 |
| 439 | JGI24699J35502_10998153 | 3300002509 | Bacteria | 1340 |
| 440 | JGI24699J35502_11134155 | 3300002509 | Bacteria | 38447 |
| 441 | Ga0068305_10002699 | 3300005083 | Bacteria | 13227 |
| 442 | Ga0068305_10042404 | 3300005083 | Unclassified | 1227 |
| 443 | Ga0103265_1000344 | 3300007068 | Bacteria | 15657 |
| 444 | Ga0102734_1000451 | 3300007129 | Bacteria | 18443 |
| 445 | Ga0102737_1000075 | 3300007142 | Bacteria | 29928 |
| 446 | Ga0105008_1015151 | 3300007507 | Bacteria | 5498 |
| 447 | Ga0123357_10001254 | 3300009784 | Bacteria | 26697 |
| 448 | Ga0466710_081066 | 3300042613 | Bacteria | 1727 |
| 449 | Ga0466715_152186 | 3300042616 | Bacteria | 37776 |
| 450 | Ga0466715_226382 | 3300042616 | Bacteria | 2704 |
| 451 | Ga0466718_151480 | 3300042617 | Bacteria | 1731 |
| 452 | Ga0466728_242816 | 3300042620 | Bacteria | 11602 |
| 453 | Ga0123357_10520826 | 3300009784 | Bacteria | 971 |
| 454 | Ga0123356_11931704 | 3300010049 | Bacteria | 735 |
| 455 | Ga0123356_12202853 | 3300010049 | Bacteria | 689 |
| 456 | Ga0123353_10802943 | 3300010167 | Bacteria | 1299 |
| 457 | Ga0123353_12832528 | 3300010167 | Bacteria | 567 |
| 458 | Ga0123353_13011338 | 3300010167 | Unclassified | 545 |
| 459 | Ga0123354_10207180 | 3300010882 | Unclassified | 2133 |
| 460 | Ga0466734_074727 | 3300042623 | Bacteria | 3099 |
| 461 | Ga0466735_061558 | 3300042624 | Bacteria | 1216 |
| 462 | Ga0466735_113605 | 3300042624 | Bacteria | 22847 |
| 463 | Ga0466735_116585 | 3300042624 | Unclassified | 1131 |
| 464 | Ga0466735_133885 | 3300042624 | Unclassified | 1088 |
| 465 | Ga0466703_045821 | 3300042636 | Bacteria | 11597 |
| 466 | Ga0466703_271286 | 3300042636 | Bacteria | 6059 |
| 467 | Ga0466709_051219 | 3300042648 | Bacteria | 17292 |
| 468 | Ga0466725_133489 | 3300042654 | Bacteria | 3091 |
| 469 | Ga0466727_032675 | 3300042655 | Bacteria | 5866 |
| 470 | Ga0466727_194949 | 3300042655 | Bacteria | 20487 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00471 | Ribosomal_L33 | Ribosomal protein L33 | 20 | 71 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.