Protein Family IF08798
Metagenome
Isolate
321
Members
92
Samples
285
Scaffolds
50.66
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_130984|Ga0466735_130984_1805_1960
- Length
- 51 aa
- Sequence
- MAKKTVASLQGGNKEGRSYTKVIKMVKSPTGSYTFNEQMVPNDKVQDFFKK
Sample Types
Isolate
11.2%
Metagenome
88.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
32.2%
Termitidae
26.7%
Kalotermitidae
15.6%
Unclassified
10.0%
Termopsidae
4.4%
Rhinotermitidae
4.4%
Passalidae
2.2%
Drosophilidae
2.2%
Hodotermitidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
286
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 4 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 5 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 17 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 18 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 19 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 20 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 23 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 24 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 25 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 26 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 27 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 42 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 43 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 44 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 52 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 53 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 54 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 55 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 56 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 57 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 58 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 59 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 60 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 61 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 62 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 63 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 64 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 65 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 66 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 67 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 68 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 69 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 70 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 71 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 72 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 73 | 3300005316 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 2 gut | Metagenome | Drosophilidae |
| 74 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 75 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 76 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 77 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 78 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 79 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 80 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 81 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 82 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 83 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 84 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 85 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 86 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 87 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 88 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 89 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 90 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 91 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 92 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_022324 | 3300042659 | Unclassified | 1150 |
| 2 | Ga0466691_151810 | 3300042593 | Unclassified | 1021 |
| 3 | Ga0466694_386770 | 3300042594 | Bacteria | 1026 |
| 4 | Ga0466696_376785 | 3300042596 | Bacteria | 25998 |
| 5 | Ga0466735_182494 | 3300042624 | Bacteria | 3923 |
| 6 | Ga0466735_222731 | 3300042624 | Unclassified | 1102 |
| 7 | Ga0466703_075868 | 3300042636 | Bacteria | 1733 |
| 8 | Ga0466727_029173 | 3300042655 | Bacteria | 13502 |
| 9 | Ga0466727_057990 | 3300042655 | Bacteria | 10301 |
| 10 | Ga0466727_150546 | 3300042655 | Bacteria | 2047 |
| 11 | Ga0466727_210639 | 3300042655 | Bacteria | 23496 |
| 12 | Ga0123355_10056099 | 3300009826 | Bacteria | 6377 |
| 13 | Ga0123353_10833861 | 3300010167 | Bacteria | 1267 |
| 14 | Ga0123353_11206113 | 3300010167 | Unclassified | 992 |
| 15 | 2227574615 | 2225789004 | Bacteria | 13777 |
| 16 | 2227580465 | 2225789004 | Bacteria | 2518 |
| 17 | IMNBL1DRAFT_c0000731 | 3300000062 | Bacteria | 26067 |
| 18 | IMNBL1DRAFT_c0011574 | 3300000062 | Bacteria | 4112 |
| 19 | IMNBL1DRAFT_c0148593 | 3300000062 | Unclassified | 602 |
| 20 | IMNBL1DRAFT_c0150871 | 3300000062 | Bacteria | 597 |
| 21 | JGI24702J35022_10004789 | 3300002462 | Bacteria | 7993 |
| 22 | JGI24702J35022_10035894 | 3300002462 | Bacteria | 2650 |
| 23 | JGI24696J40584_12814655 | 3300002834 | Bacteria | 895 |
| 24 | JGI24696J40584_12959771 | 3300002834 | Bacteria | 5614 |
| 25 | Ga0068305_10024234 | 3300005083 | Bacteria | 767 |
| 26 | Ga0072941_1015407 | 3300005201 | Bacteria | 4683 |
| 27 | Ga0466706_057633 | 3300042599 | Bacteria | 4689 |
| 28 | Ga0466713_115233 | 3300042602 | Bacteria | 28611 |
| 29 | Ga0466714_003866 | 3300042603 | Bacteria | 5731 |
| 30 | Ga0466719_001807 | 3300042606 | Bacteria | 2295 |
| 31 | Ga0466711_213693 | 3300042615 | Bacteria | 12382 |
| 32 | Ga0466711_408610 | 3300042615 | Bacteria | 17675 |
| 33 | Ga0466723_137868 | 3300042618 | Bacteria | 7658 |
| 34 | Ga0466726_081325 | 3300042619 | Bacteria | 12183 |
| 35 | Ga0466733_142535 | 3300042659 | Bacteria | 25179 |
| 36 | Ga0466735_030003 | 3300042624 | Bacteria | 1685 |
| 37 | Ga0466735_031025 | 3300042624 | Bacteria | 1989 |
| 38 | Ga0466735_176716 | 3300042624 | Unclassified | 1030 |
| 39 | Ga0466735_215242 | 3300042624 | Bacteria | 2847 |
| 40 | Ga0466735_227414 | 3300042624 | Bacteria | 1115 |
| 41 | Ga0466703_008945 | 3300042636 | Bacteria | 15665 |
| 42 | Ga0466708_058071 | 3300042652 | Bacteria | 26425 |
| 43 | Ga0123355_12140418 | 3300009826 | Bacteria | 513 |
| 44 | Ga0123356_11516151 | 3300010049 | Bacteria | 828 |
| 45 | Ga0123356_11963125 | 3300010049 | Bacteria | 729 |
| 46 | IMNBL1DRAFT_c0002818 | 3300000062 | Bacteria | 11728 |
| 47 | IMNBL1DRAFT_c0037434 | 3300000062 | Bacteria | 1681 |
| 48 | JGI24702J35022_10341639 | 3300002462 | Unclassified | 893 |
| 49 | Ga0068302_10202761 | 3300005071 | Bacteria | 2987 |
| 50 | Ga0068305_10091888 | 3300005083 | Bacteria | 522 |
| 51 | Ga0068305_10130315 | 3300005083 | Unclassified | 5626 |
| 52 | Ga0466706_028065 | 3300042599 | Bacteria | 73562 |
| 53 | Ga0466706_163273 | 3300042599 | Bacteria | 1076 |
| 54 | Ga0466706_170412 | 3300042599 | Bacteria | 1323 |
| 55 | Ga0466706_193203 | 3300042599 | Bacteria | 16873 |
| 56 | Ga0466706_263539 | 3300042599 | Bacteria | 23400 |
| 57 | Ga0466716_141061 | 3300042605 | Bacteria | 1513 |
| 58 | Ga0466716_208007 | 3300042605 | Bacteria | 10564 |
| 59 | Ga0466716_413309 | 3300042605 | Bacteria | 7186 |
| 60 | Ga0466719_043210 | 3300042606 | Bacteria | 5393 |
| 61 | Ga0466698_225151 | 3300042610 | Bacteria | 1459 |
| 62 | Ga0466715_500162 | 3300042616 | Bacteria | 8686 |
| 63 | Ga0466715_517916 | 3300042616 | Bacteria | 6354 |
| 64 | Ga0466715_523101 | 3300042616 | Bacteria | 3340 |
| 65 | Ga0466728_249094 | 3300042620 | Bacteria | 125538 |
| 66 | Ga0466705_017856 | 3300042612 | Bacteria | 8827 |
| 67 | Ga0466705_262268 | 3300042612 | Bacteria | 16867 |
| 68 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 69 | Ga0466657_184694 | 3300042582 | Unclassified | 1091 |
| 70 | Ga0466690_372162 | 3300042590 | Bacteria | 16481 |
| 71 | Ga0466692_053741 | 3300042591 | Unclassified | 2165 |
| 72 | Ga0466696_253210 | 3300042596 | Bacteria | 201850 |
| 73 | Ga0466735_078843 | 3300042624 | Unclassified | 2198 |
| 74 | Ga0466703_177396 | 3300042636 | Unclassified | 3150 |
| 75 | Ga0466704_170981 | 3300042643 | Bacteria | 2385 |
| 76 | Ga0466704_457279 | 3300042643 | Bacteria | 1138 |
| 77 | Ga0466704_605489 | 3300042643 | Bacteria | 25005 |
| 78 | Ga0466727_192304 | 3300042655 | Bacteria | 12848 |
| 79 | Ga0123356_10004417 | 3300010049 | Bacteria | 14534 |
| 80 | Ga0123356_10439269 | 3300010049 | Bacteria | 1451 |
| 81 | Ga0123356_11259665 | 3300010049 | Bacteria | 904 |
| 82 | 2227195816 | 2225789004 | Bacteria | 1452 |
| 83 | IMNBL1DRAFT_c0069760 | 3300000062 | Bacteria | 1019 |
| 84 | JGI24702J35022_10029949 | 3300002462 | Bacteria | 2920 |
| 85 | Ga0068302_10095337 | 3300005071 | Bacteria | 6024 |
| 86 | Ga0466706_030035 | 3300042599 | Unclassified | 5242 |
| 87 | Ga0466706_099033 | 3300042599 | Bacteria | 37493 |
| 88 | Ga0466706_128628 | 3300042599 | Bacteria | 4542 |
| 89 | Ga0466706_159521 | 3300042599 | Bacteria | 4958 |
| 90 | Ga0466707_197983 | 3300042601 | Bacteria | 1540 |
| 91 | Ga0466707_391768 | 3300042601 | Bacteria | 24182 |
| 92 | Ga0466713_060328 | 3300042602 | Bacteria | 119085 |
| 93 | Ga0466713_081632 | 3300042602 | Bacteria | 8129 |
| 94 | Ga0466713_105116 | 3300042602 | Unclassified | 14343 |
| 95 | Ga0466716_542401 | 3300042605 | Bacteria | 12639 |
| 96 | Ga0466722_216384 | 3300042609 | Bacteria | 4635 |
| 97 | Ga0466698_359731 | 3300042610 | Unclassified | 4482 |
| 98 | Ga0466711_093803 | 3300042615 | Bacteria | 25402 |
| 99 | Ga0466711_176920 | 3300042615 | Bacteria | 1632 |
| 100 | Ga0466711_512097 | 3300042615 | Bacteria | 10031 |
| 101 | Ga0466723_347073 | 3300042618 | Bacteria | 20744 |
| 102 | Ga0466705_277955 | 3300042612 | Bacteria | 13235 |
| 103 | Ga0466733_020732 | 3300042659 | Bacteria | 7888 |
| 104 | Ga0466733_038690 | 3300042659 | Bacteria | 100300 |
| 105 | Ga0466733_118997 | 3300042659 | Bacteria | 1005 |
| 106 | Ga0415639_136978 | 3300038395 | Unclassified | 1853 |
| 107 | Ga0466690_017303 | 3300042590 | Unclassified | 4373 |
| 108 | Ga0466690_124251 | 3300042590 | Bacteria | 8184 |
| 109 | Ga0466691_089972 | 3300042593 | Bacteria | 7881 |
| 110 | Ga0466699_005625 | 3300042597 | Bacteria | 1143 |
| 111 | Ga0466699_226737 | 3300042597 | Bacteria | 1671 |
| 112 | Ga0466704_081984 | 3300042643 | Bacteria | 15027 |
| 113 | Ga0466709_006898 | 3300042648 | Unclassified | 5152 |
| 114 | Ga0466708_145890 | 3300042652 | Bacteria | 28616 |
| 115 | Ga0123357_10328876 | 3300009784 | Bacteria | 1497 |
| 116 | Ga0123356_10959726 | 3300010049 | Unclassified | 1026 |
| 117 | Ga0123356_11176350 | 3300010049 | Bacteria | 933 |
| 118 | Ga0123353_10000041 | 3300010167 | Bacteria | 137212 |
| 119 | Ga0123353_10960054 | 3300010167 | Bacteria | 1155 |
| 120 | Ga0123353_11210416 | 3300010167 | Unclassified | 990 |
| 121 | 2227486679 | 2225789004 | Bacteria | 815 |
| 122 | 2227540478 | 2225789004 | Bacteria | 2997 |
| 123 | IMNBL1DRAFT_c0052323 | 3300000062 | Bacteria | 1280 |
| 124 | IMNBL1DRAFT_c0065173 | 3300000062 | Bacteria | 1075 |
| 125 | IMNBL1DRAFT_c0085580 | 3300000062 | Bacteria | 875 |
| 126 | JGI24698J34947_10078585 | 3300002449 | Bacteria | 1556 |
| 127 | JGI24702J35022_10002417 | 3300002462 | Bacteria | 11409 |
| 128 | JGI24702J35022_10354993 | 3300002462 | Unclassified | 877 |
| 129 | Ga0466701_075520 | 3300042598 | Bacteria | 1088 |
| 130 | Ga0466707_053432 | 3300042601 | Bacteria | 2481 |
| 131 | Ga0466714_015825 | 3300042603 | Bacteria | 102725 |
| 132 | Ga0466716_018555 | 3300042605 | Bacteria | 33125 |
| 133 | Ga0466719_102024 | 3300042606 | Bacteria | 10936 |
| 134 | Ga0466722_149354 | 3300042609 | Bacteria | 5741 |
| 135 | Ga0466710_180112 | 3300042613 | Bacteria | 2120 |
| 136 | Ga0466711_210390 | 3300042615 | Bacteria | 1698 |
| 137 | Ga0466715_165527 | 3300042616 | Bacteria | 17862 |
| 138 | Ga0466723_068280 | 3300042618 | Bacteria | 19935 |
| 139 | Ga0466728_139318 | 3300042620 | Bacteria | 53765 |
| 140 | Ga0466728_440646 | 3300042620 | Unclassified | 1873 |
| 141 | Ga0466729_074859 | 3300042621 | Bacteria | 14023 |
| 142 | Ga0466697_133473 | 3300042611 | Bacteria | 1028 |
| 143 | Ga0466692_201931 | 3300042591 | Bacteria | 20461 |
| 144 | Ga0466691_019050 | 3300042593 | Bacteria | 28586 |
| 145 | Ga0466691_038604 | 3300042593 | Bacteria | 1021 |
| 146 | Ga0466691_149521 | 3300042593 | Unclassified | 8261 |
| 147 | Ga0466694_259237 | 3300042594 | Bacteria | 1919 |
| 148 | Ga0466695_274982 | 3300042595 | Bacteria | 2416 |
| 149 | Ga0466696_503453 | 3300042596 | Bacteria | 10294 |
| 150 | Ga0466735_006320 | 3300042624 | Bacteria | 4033 |
| 151 | Ga0466730_040791 | 3300042625 | Unclassified | 1075 |
| 152 | Ga0466704_362592 | 3300042643 | Bacteria | 6525 |
| 153 | Ga0466704_444820 | 3300042643 | Bacteria | 2401 |
| 154 | Ga0466708_042712 | 3300042652 | Bacteria | 9373 |
| 155 | 2227247777 | 2225789004 | Bacteria | 1325 |
| 156 | 2227492405 | 2225789004 | Bacteria | 783 |
| 157 | JGI24702J35022_10002454 | 3300002462 | Bacteria | 11304 |
| 158 | JGI24702J35022_10104098 | 3300002462 | Bacteria | 1556 |
| 159 | JGI24702J35022_10296092 | 3300002462 | Bacteria | 954 |
| 160 | Ga0074302_1157278 | 3300005316 | Bacteria | 689 |
| 161 | Ga0466706_025174 | 3300042599 | Bacteria | 118676 |
| 162 | Ga0466706_147059 | 3300042599 | Bacteria | 2729 |
| 163 | Ga0466713_082426 | 3300042602 | Bacteria | 104514 |
| 164 | Ga0466716_397792 | 3300042605 | Bacteria | 16628 |
| 165 | Ga0466719_053145 | 3300042606 | Bacteria | 15783 |
| 166 | Ga0466719_273967 | 3300042606 | Bacteria | 1029 |
| 167 | Ga0466722_044304 | 3300042609 | Bacteria | 15633 |
| 168 | Ga0466722_186775 | 3300042609 | Unclassified | 6474 |
| 169 | Ga0466715_197940 | 3300042616 | Bacteria | 8128 |
| 170 | Ga0466723_146831 | 3300042618 | Bacteria | 32940 |
| 171 | Ga0466726_238478 | 3300042619 | Bacteria | 6103 |
| 172 | Ga0466726_245063 | 3300042619 | Bacteria | 1005 |
| 173 | Ga0466729_190196 | 3300042621 | Bacteria | 9799 |
| 174 | Ga0466733_097718 | 3300042659 | Bacteria | 15472 |
| 175 | Ga0265387_1005299 | 3300024582 | Bacteria | 1744 |
| 176 | Ga0466690_284019 | 3300042590 | Bacteria | 6716 |
| 177 | Ga0466696_046481 | 3300042596 | Bacteria | 9675 |
| 178 | Ga0466701_008346 | 3300042598 | Bacteria | 3738 |
| 179 | Ga0466735_021399 | 3300042624 | Bacteria | 17324 |
| 180 | Ga0466735_053776 | 3300042624 | Unclassified | 1060 |
| 181 | Ga0466735_130984 | 3300042624 | Bacteria | 4143 |
| 182 | Ga0466735_133656 | 3300042624 | Bacteria | 2865 |
| 183 | Ga0466703_103545 | 3300042636 | Bacteria | 1634 |
| 184 | Ga0466703_396348 | 3300042636 | Bacteria | 8038 |
| 185 | Ga0466704_038771 | 3300042643 | Unclassified | 3761 |
| 186 | Ga0466725_297803 | 3300042654 | Bacteria | 25445 |
| 187 | Ga0466727_180015 | 3300042655 | Bacteria | 1908 |
| 188 | Ga0466727_218918 | 3300042655 | Bacteria | 13170 |
| 189 | Ga0123357_10149746 | 3300009784 | Bacteria | 2837 |
| 190 | Ga0123356_13965565 | 3300010049 | Bacteria | 510 |
| 191 | Ga0123353_10657476 | 3300010167 | Unclassified | 1482 |
| 192 | Ga0123353_11235227 | 3300010167 | Bacteria | 977 |
| 193 | 2227246906 | 2225789004 | Bacteria | 1327 |
| 194 | 2227408028 | 2225789004 | Bacteria | 1063 |
| 195 | 2227564381 | 2225789004 | Bacteria | 2686 |
| 196 | IMNBL1DRAFT_c0001371 | 3300000062 | Bacteria | 18314 |
| 197 | IMNBL1DRAFT_c0024516 | 3300000062 | Bacteria | 2337 |
| 198 | JGI24698J34947_10020372 | 3300002449 | Bacteria | 3572 |
| 199 | JGI24702J35022_10164993 | 3300002462 | Bacteria | 1250 |
| 200 | Ga0068305_10048374 | 3300005083 | Bacteria | 9680 |
| 201 | Ga0466701_048254 | 3300042598 | Bacteria | 1778 |
| 202 | Ga0466707_064540 | 3300042601 | Bacteria | 6487 |
| 203 | Ga0466713_022356 | 3300042602 | Bacteria | 45305 |
| 204 | Ga0466722_042812 | 3300042609 | Bacteria | 110303 |
| 205 | Ga0466698_256438 | 3300042610 | Bacteria | 1166 |
| 206 | Ga0466711_240969 | 3300042615 | Bacteria | 7232 |
| 207 | Ga0466715_567151 | 3300042616 | Bacteria | 35252 |
| 208 | Ga0466723_160676 | 3300042618 | Bacteria | 9124 |
| 209 | Ga0466726_041856 | 3300042619 | Bacteria | 4291 |
| 210 | Ga0466726_284059 | 3300042619 | Bacteria | 1138 |
| 211 | Ga0466697_159554 | 3300042611 | Bacteria | 1080 |
| 212 | Ga0466733_045911 | 3300042659 | Bacteria | 5727 |
| 213 | Ga0466656_188267 | 3300042550 | Bacteria | 3967 |
| 214 | Ga0466696_013588 | 3300042596 | Bacteria | 10778 |
| 215 | Ga0466696_056687 | 3300042596 | Bacteria | 1376 |
| 216 | Ga0466696_110416 | 3300042596 | Bacteria | 1471 |
| 217 | Ga0466731_084116 | 3300042622 | Bacteria | 3312 |
| 218 | Ga0466735_056251 | 3300042624 | Bacteria | 13449 |
| 219 | Ga0466735_203546 | 3300042624 | Bacteria | 2788 |
| 220 | Ga0466703_359395 | 3300042636 | Bacteria | 13580 |
| 221 | Ga0466704_431046 | 3300042643 | Unclassified | 1203 |
| 222 | Ga0466709_117805 | 3300042648 | Bacteria | 9724 |
| 223 | Ga0466708_125692 | 3300042652 | Unclassified | 1416 |
| 224 | Ga0466725_311188 | 3300042654 | Bacteria | 11217 |
| 225 | Ga0123357_10429427 | 3300009784 | Bacteria | 1169 |
| 226 | Ga0123356_12232958 | 3300010049 | Bacteria | 684 |
| 227 | Ga0123356_13319552 | 3300010049 | Bacteria | 559 |
| 228 | Ga0123353_10743984 | 3300010167 | Bacteria | 1366 |
| 229 | 2227112216 | 2225789004 | Bacteria | 1739 |
| 230 | JGI24695J34938_10035803 | 3300002450 | Bacteria | 2267 |
| 231 | JGI24695J34938_10584650 | 3300002450 | Unclassified | 519 |
| 232 | JGI24702J35022_10277065 | 3300002462 | Bacteria | 983 |
| 233 | JGI24705J35276_12083655 | 3300002504 | Bacteria | 979 |
| 234 | JGI24696J40584_12756721 | 3300002834 | Bacteria | 802 |
| 235 | Ga0068302_10090017 | 3300005071 | Bacteria | 3108 |
| 236 | Ga0068305_10017541 | 3300005083 | Bacteria | 7947 |
| 237 | Ga0068305_10051546 | 3300005083 | Bacteria | 11589 |
| 238 | Ga0104050_1225203 | 3300007153 | Bacteria | 569 |
| 239 | Ga0466722_110225 | 3300042609 | Bacteria | 1847 |
| 240 | Ga0466722_162023 | 3300042609 | Bacteria | 1940 |
| 241 | Ga0466723_109130 | 3300042618 | Unclassified | 2447 |
| 242 | Ga0466726_416892 | 3300042619 | Unclassified | 5847 |
| 243 | Ga0466728_164365 | 3300042620 | Bacteria | 40566 |
| 244 | Ga0466728_318809 | 3300042620 | Bacteria | 56945 |
| 245 | Ga0466728_379247 | 3300042620 | Bacteria | 3957 |
| 246 | Ga0466697_077754 | 3300042611 | Bacteria | 1113 |
| 247 | Ga0466733_019214 | 3300042659 | Bacteria | 126944 |
| 248 | Ga0466733_181508 | 3300042659 | Bacteria | 11920 |
| 249 | Ga0466692_008426 | 3300042591 | Bacteria | 17745 |
| 250 | Ga0466694_107157 | 3300042594 | Bacteria | 1360 |
| 251 | Ga0466694_225731 | 3300042594 | Bacteria | 3614 |
| 252 | Ga0466735_061558 | 3300042624 | Bacteria | 1216 |
| 253 | Ga0466735_133885 | 3300042624 | Unclassified | 1088 |
| 254 | Ga0466703_045821 | 3300042636 | Bacteria | 11597 |
| 255 | Ga0466703_271286 | 3300042636 | Bacteria | 6059 |
| 256 | Ga0466704_318994 | 3300042643 | Unclassified | 2992 |
| 257 | Ga0466709_051219 | 3300042648 | Bacteria | 17292 |
| 258 | Ga0466727_032675 | 3300042655 | Bacteria | 5866 |
| 259 | Ga0466727_194949 | 3300042655 | Bacteria | 20487 |
| 260 | Ga0123357_10737305 | 3300009784 | Bacteria | 691 |
| 261 | Ga0123356_11302133 | 3300010049 | Bacteria | 890 |
| 262 | Ga0123356_11931704 | 3300010049 | Bacteria | 735 |
| 263 | Ga0123356_12202853 | 3300010049 | Bacteria | 689 |
| 264 | Ga0123353_10802943 | 3300010167 | Bacteria | 1299 |
| 265 | Ga0123353_11735146 | 3300010167 | Bacteria | 780 |
| 266 | Ga0123353_12832528 | 3300010167 | Bacteria | 567 |
| 267 | 2227128034 | 2225789004 | Bacteria | 9011 |
| 268 | 2227361377 | 2225789004 | Bacteria | 6087 |
| 269 | IMNBL1DRAFT_c0025311 | 3300000062 | Bacteria | 2279 |
| 270 | JGI24705J35276_12195525 | 3300002504 | Bacteria | 1526 |
| 271 | JGI24705J35276_12238563 | 3300002504 | Bacteria | 26858 |
| 272 | Ga0068305_10002699 | 3300005083 | Bacteria | 13227 |
| 273 | Ga0123357_10001254 | 3300009784 | Bacteria | 26697 |
| 274 | Ga0466706_073151 | 3300042599 | Bacteria | 10498 |
| 275 | Ga0466706_262447 | 3300042599 | Bacteria | 9282 |
| 276 | Ga0466707_088230 | 3300042601 | Bacteria | 4596 |
| 277 | Ga0466713_004309 | 3300042602 | Bacteria | 4253 |
| 278 | Ga0466714_006170 | 3300042603 | Bacteria | 1468 |
| 279 | Ga0466719_216933 | 3300042606 | Bacteria | 4391 |
| 280 | Ga0466719_434603 | 3300042606 | Bacteria | 3443 |
| 281 | Ga0466722_122079 | 3300042609 | Bacteria | 3787 |
| 282 | Ga0466698_212926 | 3300042610 | Bacteria | 1433 |
| 283 | Ga0466698_353065 | 3300042610 | Bacteria | 1935 |
| 284 | Ga0466715_183631 | 3300042616 | Bacteria | 24353 |
| 285 | Ga0466715_226382 | 3300042616 | Bacteria | 2704 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14128 | DUF4295 | Domain of unknown function (DUF4295) | 2 | 49 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.