Protein Family IF08465
Metagenome
Isolate
152
Members
62
Samples
140
Scaffolds
466.62
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_409369|Ga0466728_409369_3068_4564
- Length
- 498 aa
- Sequence
- LRNSKSGWIKRLRQNPALQIRKKPMTRNNYAKVTAEIIEELRRIAGSGNVITSEEKLEAYSHDETDAAEYGSMPEAAVLPLTTEQAAAVVKLANRERIPVTPRGAGSGLSGGAIPEYGGIVVSLERMNRLIEIDRDNMAAVVEAGMVTNDFAQAVQAEGLFFAGYPMSLQTCVIGGNIAENAGGGKAVKYGVTGRYVLGLTLVTPSGDIVELGGKLAKDVTGYDLKSLIIGSEGTLGIVTKAIIRLIGYPASKSDLLVLFKTPKEAIDLVPLVLSRGINPTSIEFMDQLSIFTSCRYLNESLPYEGCGAMLLIELDGSDGVQIERDLVETGKLCEEKGALEVYVAEDRNNIERLWNVRRNIAEAFKVYSPIQSIEDIVVPISKIPAMIPELEKLGNRYGMQIPCYGHAGDGNLHATLVKDPAMSMEEWKRNEAACLGELYSLVSSFGGKISGEHGIGIKRRKYLKDLIAPAELALMRSLKRAWDPNNIMNPGKIFESP
Sample Types
Isolate
7.9%
Metagenome
92.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.3%
Kalotermitidae
24.6%
Unclassified
19.7%
Rhinotermitidae
6.6%
Termopsidae
4.9%
Hodotermitidae
1.6%
Passalidae
1.6%
Blaberidae
1.6%
Taxonomy
Archaea
13
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2773857681 | Unclassified Methanomassiliicoccaceae Lab288P1bin114 | Isolate | Unclassified |
| 2 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 24 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 25 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 26 | 2773857697 | Unclassified Methanomassiliicoccaceae Th196P4bin34 | Isolate | Unclassified |
| 27 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2773857690 | Unclassified Methanomassiliicoccaceae Nt197P4bin30 | Isolate | Unclassified |
| 37 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 38 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 39 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 2773857688 | Unclassified Methanomassiliicoccaceae Nt197P3bin45 | Isolate | Unclassified |
| 45 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 46 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 47 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 48 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 49 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 53 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 54 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 55 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 56 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 57 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 58 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 59 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 60 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 61 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 62 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_145874 | 3300042600 | Bacteria | 1837 |
| 2 | Ga0466713_007749 | 3300042602 | Bacteria | 3691 |
| 3 | Ga0466716_039506 | 3300042605 | Bacteria | 7334 |
| 4 | Ga0466716_453615 | 3300042605 | Bacteria | 3324 |
| 5 | Ga0123353_10081822 | 3300010167 | Archaea | 5193 |
| 6 | Ga0466712_054024 | 3300042614 | Bacteria | 13818 |
| 7 | Ga0466718_034562 | 3300042617 | Unclassified | 2853 |
| 8 | Ga0466726_032098 | 3300042619 | Bacteria | 9520 |
| 9 | Ga0466703_101720 | 3300042636 | Bacteria | 1747 |
| 10 | Ga0466704_184656 | 3300042643 | Bacteria | 5704 |
| 11 | Ga0466708_310127 | 3300042652 | Bacteria | 11890 |
| 12 | AustNasuHG_c1000454 | 3300000089 | Bacteria | 14355 |
| 13 | JGI24698J34947_10000226 | 3300002449 | Bacteria | 23328 |
| 14 | JGI24698J34947_10001541 | 3300002449 | Bacteria | 12188 |
| 15 | JGI24698J34947_10005293 | 3300002449 | Bacteria | 7079 |
| 16 | JGI24702J35022_10059203 | 3300002462 | Bacteria | 2046 |
| 17 | Ga0264413_112228 | 3300024493 | Bacteria | 9702 |
| 18 | Ga0456237_0003908 | 3300041968 | Bacteria | 2401 |
| 19 | Ga0466696_425714 | 3300042596 | Bacteria | 23033 |
| 20 | Ga0466697_075904 | 3300042611 | Bacteria | 3165 |
| 21 | Ga0466717_156109 | 3300042604 | Bacteria | 1536 |
| 22 | Ga0466720_139327 | 3300042607 | Bacteria | 23939 |
| 23 | Ga0466720_147469 | 3300042607 | Bacteria | 4303 |
| 24 | Ga0123353_10006953 | 3300010167 | Bacteria | 15211 |
| 25 | Ga0123353_10123468 | 3300010167 | Bacteria | 4162 |
| 26 | Ga0123353_10270777 | 3300010167 | Bacteria | 2617 |
| 27 | Ga0466711_094892 | 3300042615 | Bacteria | 21125 |
| 28 | Ga0466715_046880 | 3300042616 | Bacteria | 6653 |
| 29 | Ga0466723_005459 | 3300042618 | Unclassified | 9795 |
| 30 | Ga0466726_191841 | 3300042619 | Bacteria | 3874 |
| 31 | Ga0466704_045761 | 3300042643 | Bacteria | 13519 |
| 32 | Ga0466709_129829 | 3300042648 | Bacteria | 9338 |
| 33 | Ga0466708_412348 | 3300042652 | Bacteria | 7288 |
| 34 | JGI24698J34947_10031686 | 3300002449 | Bacteria | 2781 |
| 35 | JGI24702J35022_10000196 | 3300002462 | Archaea | 32680 |
| 36 | Ga0466690_299307 | 3300042590 | Bacteria | 12999 |
| 37 | Ga0466695_304165 | 3300042595 | Bacteria | 3123 |
| 38 | Ga0466699_183927 | 3300042597 | Bacteria | 2717 |
| 39 | Ga0466706_204935 | 3300042599 | Bacteria | 2812 |
| 40 | Ga0466713_072124 | 3300042602 | Bacteria | 12482 |
| 41 | Ga0466713_122100 | 3300042602 | Bacteria | 19669 |
| 42 | Ga0466719_160387 | 3300042606 | Bacteria | 9209 |
| 43 | Ga0466720_179782 | 3300042607 | Bacteria | 9256 |
| 44 | Ga0123355_10296869 | 3300009826 | Bacteria | 2209 |
| 45 | Ga0123356_10083897 | 3300010049 | Bacteria | 3019 |
| 46 | Ga0123353_10001618 | 3300010167 | Bacteria | 27727 |
| 47 | Ga0123353_10015609 | 3300010167 | Archaea | 11049 |
| 48 | Ga0466718_058236 | 3300042617 | Bacteria | 6487 |
| 49 | Ga0466723_092640 | 3300042618 | Bacteria | 22958 |
| 50 | Ga0466726_285510 | 3300042619 | Bacteria | 3685 |
| 51 | Ga0466728_409369 | 3300042620 | Bacteria | 5303 |
| 52 | Ga0466727_010760 | 3300042655 | Bacteria | 16422 |
| 53 | JGI24698J34947_10012162 | 3300002449 | Bacteria | 4723 |
| 54 | JGI24705J35276_12236945 | 3300002504 | Archaea | 9380 |
| 55 | Ga0068302_10537015 | 3300005071 | Bacteria | 2950 |
| 56 | Ga0466716_208678 | 3300042605 | Bacteria | 18568 |
| 57 | Ga0466722_154238 | 3300042609 | Bacteria | 15806 |
| 58 | Ga0123353_10027889 | 3300010167 | Archaea | 8663 |
| 59 | Ga0123353_10487894 | 3300010167 | Unclassified | 1800 |
| 60 | Ga0466712_088559 | 3300042614 | Bacteria | 13759 |
| 61 | Ga0466711_135544 | 3300042615 | Bacteria | 26216 |
| 62 | Ga0466718_047698 | 3300042617 | Bacteria | 18884 |
| 63 | Ga0466723_005019 | 3300042618 | Bacteria | 8566 |
| 64 | Ga0466703_227715 | 3300042636 | Bacteria | 6797 |
| 65 | Ga0466703_332040 | 3300042636 | Bacteria | 7896 |
| 66 | Ga0466708_145254 | 3300042652 | Bacteria | 3678 |
| 67 | Ga0466708_199560 | 3300042652 | Bacteria | 6124 |
| 68 | JGI24698J34947_10018663 | 3300002449 | Unclassified | 3746 |
| 69 | Ga0264413_112229 | 3300024493 | Bacteria | 7681 |
| 70 | Ga0466657_138406 | 3300042582 | Archaea | 13828 |
| 71 | Ga0466690_252768 | 3300042590 | Bacteria | 3523 |
| 72 | Ga0466692_122999 | 3300042591 | Bacteria | 1703 |
| 73 | Ga0466695_328004 | 3300042595 | Bacteria | 2585 |
| 74 | Ga0466733_158356 | 3300042659 | Bacteria | 3787 |
| 75 | Ga0123353_10000138 | 3300010167 | Unclassified | 88507 |
| 76 | Ga0123353_10002903 | 3300010167 | Archaea | 21470 |
| 77 | Ga0123353_10018361 | 3300010167 | Bacteria | 10339 |
| 78 | Ga0123353_10129345 | 3300010167 | Bacteria | 4054 |
| 79 | Ga0466712_194173 | 3300042614 | Bacteria | 12130 |
| 80 | Ga0466715_390824 | 3300042616 | Bacteria | 4339 |
| 81 | Ga0466729_042451 | 3300042621 | Bacteria | 4155 |
| 82 | 2227386343 | 2225789004 | Archaea | 27537 |
| 83 | AustNasuHG_c1004345 | 3300000089 | Bacteria | 5081 |
| 84 | JGI24698J34947_10001765 | 3300002449 | Bacteria | 11528 |
| 85 | Ga0072940_1051651 | 3300005200 | Bacteria | 2593 |
| 86 | Ga0264413_133103 | 3300024493 | Bacteria | 6542 |
| 87 | Ga0466696_101606 | 3300042596 | Bacteria | 5494 |
| 88 | Ga0466707_102120 | 3300042601 | Bacteria | 15647 |
| 89 | Ga0466713_144820 | 3300042602 | Bacteria | 3116 |
| 90 | Ga0466720_002207 | 3300042607 | Unclassified | 5736 |
| 91 | Ga0123356_10032269 | 3300010049 | Bacteria | 4900 |
| 92 | Ga0123353_10002960 | 3300010167 | Unclassified | 21250 |
| 93 | Ga0123354_10052469 | 3300010882 | Bacteria | 6143 |
| 94 | Ga0466712_183925 | 3300042614 | Bacteria | 19044 |
| 95 | Ga0466718_032678 | 3300042617 | Bacteria | 5435 |
| 96 | Ga0466728_046550 | 3300042620 | Bacteria | 11889 |
| 97 | Ga0466728_142258 | 3300042620 | Bacteria | 12593 |
| 98 | Ga0466729_069366 | 3300042621 | Bacteria | 4817 |
| 99 | Ga0466709_274175 | 3300042648 | Bacteria | 3723 |
| 100 | 2227441919 | 2225789004 | Unclassified | 5490 |
| 101 | JGI24698J34947_10002323 | 3300002449 | Bacteria | 10218 |
| 102 | Ga0074263_108249 | 3300005485 | Bacteria | 1876 |
| 103 | Ga0466657_328821 | 3300042582 | Archaea | 5575 |
| 104 | Ga0466696_154130 | 3300042596 | Bacteria | 3437 |
| 105 | Ga0466699_002401 | 3300042597 | Bacteria | 74503 |
| 106 | Ga0466699_061048 | 3300042597 | Bacteria | 16540 |
| 107 | Ga0466699_387540 | 3300042597 | Bacteria | 2910 |
| 108 | Ga0466700_000496 | 3300042600 | Bacteria | 2501 |
| 109 | Ga0466707_015463 | 3300042601 | Bacteria | 5854 |
| 110 | Ga0466716_285335 | 3300042605 | Bacteria | 3003 |
| 111 | Ga0466715_006883 | 3300042616 | Bacteria | 4851 |
| 112 | Ga0466715_265694 | 3300042616 | Bacteria | 8468 |
| 113 | Ga0466715_293459 | 3300042616 | Bacteria | 1849 |
| 114 | Ga0466715_339215 | 3300042616 | Bacteria | 7118 |
| 115 | Ga0466723_060318 | 3300042618 | Bacteria | 4839 |
| 116 | Ga0466726_032485 | 3300042619 | Bacteria | 3957 |
| 117 | Ga0466726_275296 | 3300042619 | Bacteria | 3335 |
| 118 | Ga0466728_261982 | 3300042620 | Bacteria | 12341 |
| 119 | Ga0466731_000646 | 3300042622 | Bacteria | 5626 |
| 120 | Ga0466708_443958 | 3300042652 | Bacteria | 29019 |
| 121 | Ga0466727_077530 | 3300042655 | Bacteria | 2134 |
| 122 | Ga0074263_113373 | 3300005485 | Bacteria | 2953 |
| 123 | Ga0123357_10000921 | 3300009784 | Bacteria | 29858 |
| 124 | Ga0466656_378098 | 3300042550 | Bacteria | 11864 |
| 125 | Ga0466692_053633 | 3300042591 | Bacteria | 26307 |
| 126 | Ga0466691_212592 | 3300042593 | Bacteria | 3868 |
| 127 | Ga0466716_057586 | 3300042605 | Bacteria | 2056 |
| 128 | Ga0466722_073652 | 3300042609 | Bacteria | 7007 |
| 129 | Ga0466705_395615 | 3300042612 | Bacteria | 4188 |
| 130 | Ga0466712_075804 | 3300042614 | Bacteria | 38150 |
| 131 | Ga0466723_035396 | 3300042618 | Bacteria | 6943 |
| 132 | Ga0466723_169486 | 3300042618 | Bacteria | 9216 |
| 133 | Ga0466726_359327 | 3300042619 | Bacteria | 15666 |
| 134 | Ga0466726_365204 | 3300042619 | Bacteria | 6611 |
| 135 | Ga0466727_019169 | 3300042655 | Bacteria | 6986 |
| 136 | JGI24698J34947_10008006 | 3300002449 | Unclassified | 5801 |
| 137 | Ga0466692_180683 | 3300042591 | Bacteria | 6544 |
| 138 | Ga0466694_109741 | 3300042594 | Bacteria | 2685 |
| 139 | Ga0466696_204934 | 3300042596 | Bacteria | 4310 |
| 140 | Ga0466699_149725 | 3300042597 | Bacteria | 3341 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01565 | GO:0050660 | flavin adenine dinucleotide binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.