Protein Family IF08436
Metagenome
Metatranscriptome
Isolate
241
Members
75
Samples
222
Scaffolds
182.39
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_234076|Ga0466728_234076_361_1002
- Length
- 213 aa
- Sequence
- MNCDRCPLFLYQYAKMSQILFFQKTITFAQNINDIMKEEIIIAGFGGQGVLSMGKILAYSGIMQGQEVTWMPAYGPEMRGGTANVTVILSDEMISSPIVGSYDTAIILNQQSMTKFEKTVKPGGLLLYDPNGIAAPPTRKDIKIHKIEAAAEAAKLNNSRLFNMIVLGGFLKIKPIVKDENVIAGLKKSLPERHHKLIPLNEKAIERGKEIVV
Sample Types
Isolate
7.9%
Metagenome
91.7%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.0%
Unclassified
28.8%
Kalotermitidae
19.2%
Termopsidae
5.5%
Rhinotermitidae
4.1%
Passalidae
2.7%
Hodotermitidae
1.4%
Blattidae
1.4%
Taxonomy
Archaea
0
Bacteria
200
Eukaryota
0
Viruses
0
Unclassified
41
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 2 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 10 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 15 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 22 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 23 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 24 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 27 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 28 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 29 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 34 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 35 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 36 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 37 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 40 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 47 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 48 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 49 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 50 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 51 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 52 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 55 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 58 | 2820735654 | Unclassified Bacteroidetes Th196P4bin9 | Isolate | Unclassified |
| 59 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 60 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 61 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 62 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 66 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 67 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 68 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 69 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 70 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 71 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 72 | 3300021244 | Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA | Metatranscriptome | Termitidae |
| 73 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 74 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 75 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_056137 | 3300042612 | Unclassified | 4105 |
| 2 | Ga0466733_016336 | 3300042659 | Bacteria | 6943 |
| 3 | Ga0466710_222547 | 3300042613 | Bacteria | 2142 |
| 4 | Ga0466715_493763 | 3300042616 | Bacteria | 2304 |
| 5 | Ga0466723_051353 | 3300042618 | Bacteria | 17108 |
| 6 | Ga0466723_081574 | 3300042618 | Unclassified | 5521 |
| 7 | Ga0466656_130106 | 3300042550 | Bacteria | 1283 |
| 8 | Ga0466690_251639 | 3300042590 | Bacteria | 10986 |
| 9 | Ga0466691_133076 | 3300042593 | Bacteria | 13556 |
| 10 | Ga0466691_140254 | 3300042593 | Bacteria | 8192 |
| 11 | Ga0466699_432843 | 3300042597 | Bacteria | 1950 |
| 12 | Ga0123353_10441318 | 3300010167 | Unclassified | 1920 |
| 13 | Ga0466708_368954 | 3300042652 | Unclassified | 6722 |
| 14 | Ga0466701_049959 | 3300042598 | Unclassified | 1451 |
| 15 | Ga0466701_053634 | 3300042598 | Unclassified | 1373 |
| 16 | Ga0466707_272877 | 3300042601 | Bacteria | 1784 |
| 17 | Ga0466716_176330 | 3300042605 | Bacteria | 10921 |
| 18 | Ga0466719_274027 | 3300042606 | Unclassified | 1763 |
| 19 | Ga0466722_253169 | 3300042609 | Unclassified | 5102 |
| 20 | 2227605185 | 2225789004 | Bacteria | 12251 |
| 21 | Ga0068302_10073534 | 3300005071 | Bacteria | 1157 |
| 22 | Ga0068305_10220819 | 3300005083 | Bacteria | 3971 |
| 23 | Ga0466705_003111 | 3300042612 | Bacteria | 15769 |
| 24 | Ga0466732_209582 | 3300042656 | Bacteria | 1309 |
| 25 | Ga0466705_425320 | 3300042612 | Bacteria | 6449 |
| 26 | Ga0466710_010729 | 3300042613 | Bacteria | 3397 |
| 27 | Ga0466711_095177 | 3300042615 | Bacteria | 4586 |
| 28 | Ga0466723_253149 | 3300042618 | Bacteria | 9220 |
| 29 | Ga0466728_167733 | 3300042620 | Bacteria | 6081 |
| 30 | Ga0466690_042562 | 3300042590 | Unclassified | 3307 |
| 31 | Ga0466690_158897 | 3300042590 | Bacteria | 2756 |
| 32 | Ga0466690_190102 | 3300042590 | Bacteria | 13314 |
| 33 | Ga0466696_147883 | 3300042596 | Bacteria | 4643 |
| 34 | Ga0466696_304901 | 3300042596 | Bacteria | 4678 |
| 35 | Ga0466696_488609 | 3300042596 | Bacteria | 4358 |
| 36 | Ga0466699_238576 | 3300042597 | Bacteria | 1177 |
| 37 | Ga0123355_10000037 | 3300009826 | Bacteria | 130470 |
| 38 | Ga0123356_10785492 | 3300010049 | Bacteria | 1123 |
| 39 | Ga0123353_10002464 | 3300010167 | Bacteria | 23020 |
| 40 | Ga0466735_052273 | 3300042624 | Bacteria | 7940 |
| 41 | Ga0466735_105515 | 3300042624 | Bacteria | 7803 |
| 42 | Ga0466704_084277 | 3300042643 | Bacteria | 17901 |
| 43 | Ga0466708_035698 | 3300042652 | Bacteria | 18360 |
| 44 | Ga0466727_083489 | 3300042655 | Bacteria | 12885 |
| 45 | Ga0466713_114182 | 3300042602 | Bacteria | 2019 |
| 46 | Ga0466714_117439 | 3300042603 | Bacteria | 74258 |
| 47 | Ga0466719_471553 | 3300042606 | Bacteria | 2167 |
| 48 | 2227477119 | 2225789004 | Bacteria | 4600 |
| 49 | IMNBL1DRAFT_c0000270 | 3300000062 | Bacteria | 45954 |
| 50 | JGI24702J35022_10017754 | 3300002462 | Bacteria | 3884 |
| 51 | JGI24702J35022_10039147 | 3300002462 | Bacteria | 2530 |
| 52 | Ga0068302_10027027 | 3300005071 | Bacteria | 5714 |
| 53 | Ga0072941_1188516 | 3300005201 | Bacteria | 2849 |
| 54 | Ga0466697_118311 | 3300042611 | Bacteria | 1456 |
| 55 | Ga0466705_529005 | 3300042612 | Bacteria | 4398 |
| 56 | Ga0466710_219711 | 3300042613 | Bacteria | 1093 |
| 57 | Ga0466715_598055 | 3300042616 | Unclassified | 2096 |
| 58 | Ga0466726_118645 | 3300042619 | Bacteria | 5836 |
| 59 | Ga0466728_234076 | 3300042620 | Bacteria | 1401 |
| 60 | Ga0466729_035209 | 3300042621 | Bacteria | 2027 |
| 61 | Ga0466729_133235 | 3300042621 | Bacteria | 11855 |
| 62 | Ga0466656_320878 | 3300042550 | Bacteria | 6913 |
| 63 | Ga0466657_347685 | 3300042582 | Unclassified | 4219 |
| 64 | Ga0466690_006321 | 3300042590 | Bacteria | 26744 |
| 65 | Ga0466694_168499 | 3300042594 | Bacteria | 1714 |
| 66 | Ga0466694_366607 | 3300042594 | Bacteria | 2039 |
| 67 | Ga0466696_089643 | 3300042596 | Bacteria | 20002 |
| 68 | Ga0123356_10154921 | 3300010049 | Bacteria | 2280 |
| 69 | Ga0123356_10282968 | 3300010049 | Bacteria | 1755 |
| 70 | Ga0466703_006902 | 3300042636 | Bacteria | 14487 |
| 71 | Ga0466703_007528 | 3300042636 | Bacteria | 8233 |
| 72 | Ga0466703_115451 | 3300042636 | Bacteria | 15572 |
| 73 | Ga0466704_482970 | 3300042643 | Bacteria | 19469 |
| 74 | Ga0466704_496721 | 3300042643 | Unclassified | 1682 |
| 75 | Ga0466704_599220 | 3300042643 | Unclassified | 5918 |
| 76 | Ga0466709_099916 | 3300042648 | Unclassified | 6882 |
| 77 | Ga0466708_158179 | 3300042652 | Bacteria | 16086 |
| 78 | Ga0466708_363355 | 3300042652 | Bacteria | 3253 |
| 79 | Ga0466714_101114 | 3300042603 | Bacteria | 64102 |
| 80 | Ga0466719_180231 | 3300042606 | Bacteria | 22873 |
| 81 | Ga0466698_419574 | 3300042610 | Bacteria | 3238 |
| 82 | 2227485204 | 2225789004 | Unclassified | 4275 |
| 83 | Ga0072940_1177860 | 3300005200 | Bacteria | 1998 |
| 84 | Ga0466705_046890 | 3300042612 | Bacteria | 10925 |
| 85 | Ga0466705_226396 | 3300042612 | Bacteria | 7133 |
| 86 | Ga0466705_286694 | 3300042612 | Bacteria | 89956 |
| 87 | Ga0466705_304351 | 3300042612 | Bacteria | 2509 |
| 88 | Ga0466710_086792 | 3300042613 | Bacteria | 1778 |
| 89 | Ga0466718_107876 | 3300042617 | Bacteria | 1497 |
| 90 | Ga0466723_069422 | 3300042618 | Bacteria | 22289 |
| 91 | Ga0466726_136943 | 3300042619 | Bacteria | 4377 |
| 92 | Ga0466728_409139 | 3300042620 | Unclassified | 2191 |
| 93 | Ga0466657_081089 | 3300042582 | Bacteria | 11471 |
| 94 | Ga0466690_000461 | 3300042590 | Bacteria | 7681 |
| 95 | Ga0466691_021872 | 3300042593 | Bacteria | 6023 |
| 96 | Ga0466695_371192 | 3300042595 | Bacteria | 14368 |
| 97 | Ga0466696_264305 | 3300042596 | Bacteria | 8070 |
| 98 | Ga0123355_10000354 | 3300009826 | Bacteria | 59454 |
| 99 | Ga0123356_10171455 | 3300010049 | Bacteria | 2181 |
| 100 | Ga0466729_197197 | 3300042621 | Unclassified | 1067 |
| 101 | Ga0466703_085361 | 3300042636 | Unclassified | 8912 |
| 102 | Ga0466704_035099 | 3300042643 | Bacteria | 4591 |
| 103 | Ga0466704_422083 | 3300042643 | Bacteria | 21259 |
| 104 | Ga0466709_339484 | 3300042648 | Bacteria | 169915 |
| 105 | Ga0466716_101719 | 3300042605 | Bacteria | 1162 |
| 106 | Ga0466722_043194 | 3300042609 | Bacteria | 4633 |
| 107 | Ga0466722_142508 | 3300042609 | Bacteria | 1324 |
| 108 | Ga0466698_019070 | 3300042610 | Bacteria | 1518 |
| 109 | Ga0466697_023828 | 3300042611 | Unclassified | 1223 |
| 110 | Ga0072941_1056701 | 3300005201 | Bacteria | 6897 |
| 111 | Ga0466732_206004 | 3300042656 | Bacteria | 2218 |
| 112 | Ga0466732_234508 | 3300042656 | Bacteria | 9038 |
| 113 | Ga0466733_074614 | 3300042659 | Bacteria | 5548 |
| 114 | Ga0466733_123823 | 3300042659 | Bacteria | 10632 |
| 115 | Ga0466712_037439 | 3300042614 | Bacteria | 2314 |
| 116 | Ga0466711_043594 | 3300042615 | Bacteria | 4540 |
| 117 | Ga0466711_056937 | 3300042615 | Bacteria | 19166 |
| 118 | Ga0466711_492858 | 3300042615 | Bacteria | 3792 |
| 119 | Ga0466715_318045 | 3300042616 | Unclassified | 3797 |
| 120 | Ga0466728_102467 | 3300042620 | Bacteria | 4910 |
| 121 | Ga0466729_104577 | 3300042621 | Bacteria | 1189 |
| 122 | Ga0223686_1064433 | 3300021244 | Bacteria | 1108 |
| 123 | Ga0466656_234524 | 3300042550 | Unclassified | 2204 |
| 124 | Ga0466692_008449 | 3300042591 | Bacteria | 3541 |
| 125 | Ga0466696_075888 | 3300042596 | Bacteria | 18472 |
| 126 | Ga0466699_161430 | 3300042597 | Bacteria | 3346 |
| 127 | Ga0466699_425919 | 3300042597 | Bacteria | 1020 |
| 128 | Ga0466701_003755 | 3300042598 | Bacteria | 3570 |
| 129 | Ga0123356_10080461 | 3300010049 | Unclassified | 3081 |
| 130 | Ga0123356_10435027 | 3300010049 | Bacteria | 1457 |
| 131 | Ga0123353_10330060 | 3300010167 | Unclassified | 2310 |
| 132 | Ga0123353_10337926 | 3300010167 | Unclassified | 2276 |
| 133 | Ga0123353_10824015 | 3300010167 | Bacteria | 1277 |
| 134 | Ga0123354_10314208 | 3300010882 | Unclassified | 1457 |
| 135 | Ga0123354_10326084 | 3300010882 | Bacteria | 1408 |
| 136 | Ga0466703_148447 | 3300042636 | Bacteria | 7678 |
| 137 | Ga0466703_211376 | 3300042636 | Bacteria | 17137 |
| 138 | Ga0466709_306239 | 3300042648 | Bacteria | 3054 |
| 139 | Ga0466700_341734 | 3300042600 | Bacteria | 1582 |
| 140 | Ga0466722_028788 | 3300042609 | Bacteria | 9118 |
| 141 | IMNBL1DRAFT_c0003736 | 3300000062 | Bacteria | 9544 |
| 142 | IMNBL1DRAFT_c0016070 | 3300000062 | Bacteria | 3219 |
| 143 | Ga0072941_1283594 | 3300005201 | Bacteria | 3515 |
| 144 | Ga0466733_136879 | 3300042659 | Bacteria | 1255 |
| 145 | Ga0466710_089436 | 3300042613 | Unclassified | 1530 |
| 146 | Ga0466710_093951 | 3300042613 | Unclassified | 1270 |
| 147 | Ga0466715_232647 | 3300042616 | Bacteria | 2842 |
| 148 | Ga0466718_074297 | 3300042617 | Bacteria | 2020 |
| 149 | Ga0466723_068620 | 3300042618 | Bacteria | 26399 |
| 150 | Ga0466723_087637 | 3300042618 | Bacteria | 2629 |
| 151 | Ga0466693_112312 | 3300042592 | Bacteria | 4297 |
| 152 | Ga0466691_003533 | 3300042593 | Unclassified | 8640 |
| 153 | Ga0466696_194897 | 3300042596 | Bacteria | 5758 |
| 154 | Ga0466699_313621 | 3300042597 | Bacteria | 4960 |
| 155 | Ga0123357_10022395 | 3300009784 | Bacteria | 8466 |
| 156 | Ga0123356_11068060 | 3300010049 | Bacteria | 976 |
| 157 | Ga0466703_143120 | 3300042636 | Bacteria | 14478 |
| 158 | Ga0466703_411517 | 3300042636 | Bacteria | 1404 |
| 159 | Ga0466713_090462 | 3300042602 | Bacteria | 11495 |
| 160 | Ga0466713_111866 | 3300042602 | Bacteria | 15277 |
| 161 | Ga0466719_212931 | 3300042606 | Unclassified | 3325 |
| 162 | Ga0466722_163418 | 3300042609 | Bacteria | 1040 |
| 163 | JGI24702J35022_10151897 | 3300002462 | Unclassified | 1300 |
| 164 | Ga0466705_044057 | 3300042612 | Unclassified | 12361 |
| 165 | Ga0466732_120715 | 3300042656 | Bacteria | 1713 |
| 166 | Ga0466715_305368 | 3300042616 | Bacteria | 16066 |
| 167 | Ga0466715_642906 | 3300042616 | Bacteria | 31038 |
| 168 | Ga0466726_050706 | 3300042619 | Bacteria | 14672 |
| 169 | Ga0466728_120182 | 3300042620 | Bacteria | 5642 |
| 170 | Ga0466728_135763 | 3300042620 | Bacteria | 10186 |
| 171 | Ga0265387_1069392 | 3300024582 | Bacteria | 676 |
| 172 | Ga0466656_206909 | 3300042550 | Bacteria | 1551 |
| 173 | Ga0466693_077110 | 3300042592 | Bacteria | 5597 |
| 174 | Ga0466691_089325 | 3300042593 | Bacteria | 13196 |
| 175 | Ga0466691_118457 | 3300042593 | Bacteria | 12333 |
| 176 | Ga0466696_060696 | 3300042596 | Bacteria | 2668 |
| 177 | Ga0123353_10061334 | 3300010167 | Bacteria | 6031 |
| 178 | Ga0123353_10094276 | 3300010167 | Bacteria | 4823 |
| 179 | Ga0466731_186099 | 3300042622 | Unclassified | 1812 |
| 180 | Ga0466735_014175 | 3300042624 | Bacteria | 6184 |
| 181 | Ga0466704_320623 | 3300042643 | Bacteria | 11414 |
| 182 | Ga0466706_023892 | 3300042599 | Bacteria | 11732 |
| 183 | Ga0466706_034227 | 3300042599 | Bacteria | 77665 |
| 184 | Ga0466719_360929 | 3300042606 | Bacteria | 1616 |
| 185 | Ga0466720_123943 | 3300042607 | Bacteria | 4633 |
| 186 | 2227275225 | 2225789004 | Bacteria | 30519 |
| 187 | JGI24702J35022_10076427 | 3300002462 | Bacteria | 1809 |
| 188 | Ga0072941_1474109 | 3300005201 | Bacteria | 1362 |
| 189 | Ga0466732_418847 | 3300042656 | Bacteria | 4776 |
| 190 | Ga0466733_138263 | 3300042659 | Bacteria | 2338 |
| 191 | Ga0466715_155882 | 3300042616 | Bacteria | 17371 |
| 192 | Ga0466723_129136 | 3300042618 | Bacteria | 27423 |
| 193 | Ga0466723_229983 | 3300042618 | Unclassified | 4605 |
| 194 | Ga0466726_167508 | 3300042619 | Bacteria | 1172 |
| 195 | Ga0466728_094013 | 3300042620 | Bacteria | 5130 |
| 196 | Ga0466657_039950 | 3300042582 | Unclassified | 7231 |
| 197 | Ga0466690_002868 | 3300042590 | Bacteria | 3951 |
| 198 | Ga0466691_041625 | 3300042593 | Unclassified | 11965 |
| 199 | Ga0466691_189514 | 3300042593 | Bacteria | 1126 |
| 200 | Ga0466694_261601 | 3300042594 | Bacteria | 8982 |
| 201 | Ga0466696_085915 | 3300042596 | Bacteria | 14982 |
| 202 | Ga0123355_10651611 | 3300009826 | Unclassified | 1229 |
| 203 | Ga0123353_10091765 | 3300010167 | Bacteria | 4892 |
| 204 | Ga0123353_10383474 | 3300010167 | Bacteria | 2101 |
| 205 | Ga0123353_11386673 | 3300010167 | Bacteria | 905 |
| 206 | Ga0466731_063618 | 3300042622 | Bacteria | 1873 |
| 207 | Ga0466731_224814 | 3300042622 | Bacteria | 16033 |
| 208 | Ga0466703_163804 | 3300042636 | Unclassified | 2333 |
| 209 | Ga0466704_340789 | 3300042643 | Bacteria | 1303 |
| 210 | Ga0466708_066930 | 3300042652 | Unclassified | 5011 |
| 211 | Ga0466708_160180 | 3300042652 | Bacteria | 3302 |
| 212 | Ga0466708_220988 | 3300042652 | Bacteria | 1655 |
| 213 | Ga0466727_144777 | 3300042655 | Unclassified | 2582 |
| 214 | Ga0466701_020846 | 3300042598 | Bacteria | 5776 |
| 215 | Ga0466716_518992 | 3300042605 | Bacteria | 11175 |
| 216 | Ga0466719_158895 | 3300042606 | Bacteria | 3471 |
| 217 | Ga0466719_447728 | 3300042606 | Unclassified | 1399 |
| 218 | Ga0466719_472004 | 3300042606 | Unclassified | 2499 |
| 219 | Ga0466721_002778 | 3300042608 | Bacteria | 7241 |
| 220 | Ga0466722_106128 | 3300042609 | Bacteria | 6791 |
| 221 | IMNBL1DRAFT_c0050959 | 3300000062 | Bacteria | 1307 |
| 222 | JGI24702J35022_10188029 | 3300002462 | Bacteria | 1177 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01558 | POR | Pyruvate ferredoxin/flavodoxin oxidoreductase | 46 | 209 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01558 | GO:0016903 | oxidoreductase activity, acting on the aldehyde or oxo group of donors | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.