Protein Family IF08285
Metagenome
Isolate
143
Members
65
Samples
135
Scaffolds
108.92
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_260872|Ga0466726_260872_1334_1714
- Length
- 126 aa
- Sequence
- MRQAQIFFRGRLAGILTEDEEGYAFRYTDAWLREETAEGISLTMPLTESLFHSRVLFPFFDGLIPEGWLLELAETSWKIDRRDRMGLLLACCKDCIGAVSVVPAGPETGSDSKTDAEAVPMGVQGK
Sample Types
Isolate
5.6%
Metagenome
94.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.1%
Kalotermitidae
13.8%
Unclassified
10.8%
Termopsidae
6.2%
Formicidae
4.6%
Armadillidiidae
4.6%
Drosophilidae
4.6%
Passalidae
3.1%
Rhinotermitidae
3.1%
Blattidae
1.5%
Hodotermitidae
1.5%
Harpacticidae
1.5%
Bombycidae
1.5%
Taxonomy
Archaea
3
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2698536704 | Methanimicrococcus blatticola PA | Isolate | Blattidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 5 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 6 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 11 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 17 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 18 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 19 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 20 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 21 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 25 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 35 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 36 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 37 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 38 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 39 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 45 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 46 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 48 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 49 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 50 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 53 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 55 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 56 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 57 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 58 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 61 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 62 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 63 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 64 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 65 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_12128407 | 3300010167 | Unclassified | 682 |
| 2 | Ga0123353_12835406 | 3300010167 | Unclassified | 567 |
| 3 | Ga0123354_11048685 | 3300010882 | Bacteria | 521 |
| 4 | Ga0466703_321275 | 3300042636 | Bacteria | 2454 |
| 5 | Ga0466704_203212 | 3300042643 | Bacteria | 15454 |
| 6 | Ga0466704_575613 | 3300042643 | Bacteria | 21883 |
| 7 | Ga0466724_08432 | 3300042649 | Bacteria | 1171 |
| 8 | Ga0466707_163289 | 3300042601 | Bacteria | 1886 |
| 9 | IMNBL1DRAFT_c0000664 | 3300000062 | Bacteria | 27514 |
| 10 | JGI24702J35022_10027239 | 3300002462 | Unclassified | 3075 |
| 11 | JGI24702J35022_10032569 | 3300002462 | Bacteria | 2790 |
| 12 | JGI24702J35022_10035525 | 3300002462 | Bacteria | 2665 |
| 13 | Ga0068305_10316967 | 3300005083 | Bacteria | 1612 |
| 14 | Ga0104048_1170549 | 3300007143 | Bacteria | 1661 |
| 15 | Ga0103267_1001796 | 3300007190 | Bacteria | 5352 |
| 16 | Ga0466710_272885 | 3300042613 | Bacteria | 1105 |
| 17 | Ga0466712_178973 | 3300042614 | Bacteria | 1428 |
| 18 | Ga0123355_10728685 | 3300009826 | Bacteria | 1128 |
| 19 | Ga0123356_10094417 | 3300010049 | Bacteria | 2856 |
| 20 | Ga0123356_10972256 | 3300010049 | Bacteria | 1019 |
| 21 | Ga0123356_12069074 | 3300010049 | Unclassified | 711 |
| 22 | Ga0123353_12443518 | 3300010167 | Bacteria | 623 |
| 23 | Ga0123354_10479184 | 3300010882 | Bacteria | 985 |
| 24 | Ga0123354_10611995 | 3300010882 | Bacteria | 794 |
| 25 | Ga0466699_328609 | 3300042597 | Bacteria | 1080 |
| 26 | Ga0466706_148817 | 3300042599 | Bacteria | 1377 |
| 27 | Ga0466700_276213 | 3300042600 | Bacteria | 4382 |
| 28 | Ga0466707_400659 | 3300042601 | Bacteria | 2609 |
| 29 | 2227549663 | 2225789004 | Bacteria | 2868 |
| 30 | JGI24702J35022_10028527 | 3300002462 | Bacteria | 2998 |
| 31 | JGI24702J35022_10185873 | 3300002462 | Bacteria | 1183 |
| 32 | Ga0102735_1001534 | 3300007080 | Bacteria | 3871 |
| 33 | Ga0466710_380712 | 3300042613 | Bacteria | 1644 |
| 34 | Ga0466715_272480 | 3300042616 | Bacteria | 5909 |
| 35 | Ga0466718_065423 | 3300042617 | Bacteria | 1220 |
| 36 | Ga0466726_178981 | 3300042619 | Bacteria | 3251 |
| 37 | Ga0466697_228570 | 3300042611 | Bacteria | 1173 |
| 38 | Ga0466732_317795 | 3300042656 | Bacteria | 1596 |
| 39 | Ga0123356_12223334 | 3300010049 | Bacteria | 686 |
| 40 | Ga0160433_111977 | 3300012846 | Bacteria | 1098 |
| 41 | Ga0466656_085533 | 3300042550 | Bacteria | 4656 |
| 42 | Ga0466704_614511 | 3300042643 | Bacteria | 2599 |
| 43 | Ga0466708_043653 | 3300042652 | Bacteria | 9633 |
| 44 | Ga0466725_419584 | 3300042654 | Bacteria | 3242 |
| 45 | Ga0466701_028509 | 3300042598 | Bacteria | 3824 |
| 46 | Ga0466707_200153 | 3300042601 | Bacteria | 1209 |
| 47 | Ga0466707_227980 | 3300042601 | Bacteria | 2637 |
| 48 | Ga0466707_326799 | 3300042601 | Bacteria | 1755 |
| 49 | Ga0466717_036496 | 3300042604 | Bacteria | 3241 |
| 50 | Ga0466717_060903 | 3300042604 | Bacteria | 1139 |
| 51 | Ga0466717_129966 | 3300042604 | Bacteria | 3155 |
| 52 | TM1208_contig21060 | 2021593000 | Bacteria | 775 |
| 53 | Ga0466710_387245 | 3300042613 | Bacteria | 5913 |
| 54 | Ga0466726_260872 | 3300042619 | Bacteria | 2464 |
| 55 | Ga0466728_069674 | 3300042620 | Bacteria | 1614 |
| 56 | Ga0123356_10513217 | 3300010049 | Unclassified | 1356 |
| 57 | Ga0123353_10176136 | 3300010167 | Bacteria | 3391 |
| 58 | Ga0123353_10330697 | 3300010167 | Bacteria | 2307 |
| 59 | Ga0466735_126619 | 3300042624 | Bacteria | 1979 |
| 60 | Ga0466708_163650 | 3300042652 | Bacteria | 19190 |
| 61 | Ga0466701_080892 | 3300042598 | Bacteria | 3915 |
| 62 | Ga0466714_131094 | 3300042603 | Bacteria | 22446 |
| 63 | Ga0466722_076418 | 3300042609 | Bacteria | 1933 |
| 64 | JGI24702J35022_10000464 | 3300002462 | Bacteria | 24409 |
| 65 | JGI24702J35022_10616552 | 3300002462 | Bacteria | 672 |
| 66 | Ga0102740_1001096 | 3300007140 | Bacteria | 7084 |
| 67 | Ga0466710_051755 | 3300042613 | Bacteria | 1236 |
| 68 | Ga0466711_068946 | 3300042615 | Bacteria | 1342 |
| 69 | Ga0466697_160976 | 3300042611 | Bacteria | 1959 |
| 70 | Ga0466733_157179 | 3300042659 | Bacteria | 1609 |
| 71 | Ga0123357_10631011 | 3300009784 | Bacteria | 804 |
| 72 | Ga0123356_11848965 | 3300010049 | Bacteria | 751 |
| 73 | Ga0160467_100017 | 3300012829 | Bacteria | 333132 |
| 74 | Ga0466703_332216 | 3300042636 | Bacteria | 16803 |
| 75 | Ga0466727_243239 | 3300042655 | Bacteria | 9605 |
| 76 | Ga0466707_342901 | 3300042601 | Bacteria | 1585 |
| 77 | Ga0466719_372214 | 3300042606 | Bacteria | 1697 |
| 78 | IMNBL1DRAFT_c0058911 | 3300000062 | Bacteria | 1164 |
| 79 | JGI24698J34947_10005222 | 3300002449 | Unclassified | 7127 |
| 80 | JGI24705J35276_11923422 | 3300002504 | Bacteria | 770 |
| 81 | Ga0068302_10416814 | 3300005071 | Bacteria | 735 |
| 82 | Ga0104045_1076765 | 3300007085 | Bacteria | 1631 |
| 83 | Ga0104044_1153480 | 3300007136 | Bacteria | 870 |
| 84 | Ga0466697_097682 | 3300042611 | Bacteria | 1448 |
| 85 | Ga0466705_237986 | 3300042612 | Bacteria | 6903 |
| 86 | Ga0123354_10883077 | 3300010882 | Bacteria | 589 |
| 87 | Ga0160443_103092 | 3300012848 | Bacteria | 3115 |
| 88 | Ga0466694_239687 | 3300042594 | Bacteria | 1472 |
| 89 | Ga0466704_082775 | 3300042643 | Bacteria | 14516 |
| 90 | Ga0466708_232815 | 3300042652 | Bacteria | 2179 |
| 91 | Ga0466707_174399 | 3300042601 | Bacteria | 9055 |
| 92 | Ga0466707_208036 | 3300042601 | Bacteria | 1488 |
| 93 | Ga0466707_217444 | 3300042601 | Bacteria | 37606 |
| 94 | Ga0466717_298062 | 3300042604 | Bacteria | 2148 |
| 95 | Ga0466716_352133 | 3300042605 | Bacteria | 1024 |
| 96 | 2227522512 | 2225789004 | Bacteria | 659 |
| 97 | JGI24705J35276_12219380 | 3300002504 | Unclassified | 2202 |
| 98 | JGI24699J35502_11134191 | 3300002509 | Bacteria | 50084 |
| 99 | JGI24696J40584_12721872 | 3300002834 | Unclassified | 760 |
| 100 | Ga0103267_1004863 | 3300007190 | Bacteria | 3708 |
| 101 | Ga0466715_434918 | 3300042616 | Bacteria | 10816 |
| 102 | Ga0466726_350514 | 3300042619 | Unclassified | 1004 |
| 103 | Ga0466726_367858 | 3300042619 | Bacteria | 2827 |
| 104 | Ga0466733_171807 | 3300042659 | Archaea | 20753 |
| 105 | Ga0123355_11651210 | 3300009826 | Unclassified | 614 |
| 106 | Ga0123356_12036628 | 3300010049 | Bacteria | 716 |
| 107 | Ga0123356_13114651 | 3300010049 | Bacteria | 578 |
| 108 | Ga0123353_10206333 | 3300010167 | Bacteria | 3087 |
| 109 | Ga0123353_10947516 | 3300010167 | Bacteria | 1165 |
| 110 | Ga0466731_141303 | 3300042622 | Unclassified | 1204 |
| 111 | Ga0466734_082008 | 3300042623 | Bacteria | 2102 |
| 112 | Ga0466706_107430 | 3300042599 | Bacteria | 1533 |
| 113 | Ga0466707_048840 | 3300042601 | Bacteria | 2106 |
| 114 | Ga0466719_170074 | 3300042606 | Bacteria | 1912 |
| 115 | IMNBL1DRAFT_c0060002 | 3300000062 | Bacteria | 1148 |
| 116 | JGI24698J34947_10340477 | 3300002449 | Bacteria | 528 |
| 117 | JGI24705J35276_11962953 | 3300002504 | Unclassified | 807 |
| 118 | Ga0068305_10022371 | 3300005083 | Bacteria | 13358 |
| 119 | Ga0466711_268824 | 3300042615 | Bacteria | 2347 |
| 120 | Ga0466694_400350 | 3300042594 | Bacteria | 1749 |
| 121 | Ga0466731_077297 | 3300042622 | Bacteria | 2669 |
| 122 | Ga0466735_147169 | 3300042624 | Archaea | 1310 |
| 123 | Ga0466707_027666 | 3300042601 | Bacteria | 1399 |
| 124 | Ga0466707_210439 | 3300042601 | Bacteria | 2150 |
| 125 | Ga0466717_226440 | 3300042604 | Bacteria | 1203 |
| 126 | Ga0466698_417273 | 3300042610 | Bacteria | 1330 |
| 127 | 2227091938 | 2225789004 | Bacteria | 9777 |
| 128 | 2227607688 | 2225789004 | Bacteria | 2286 |
| 129 | IMNBL1DRAFT_c0001194 | 3300000062 | Bacteria | 19738 |
| 130 | IMNBL1DRAFT_c0038412 | 3300000062 | Unclassified | 1647 |
| 131 | JGI24702J35022_10111534 | 3300002462 | Bacteria | 1504 |
| 132 | JGI24702J35022_10357227 | 3300002462 | Bacteria | 874 |
| 133 | JGI24696J40584_12927544 | 3300002834 | Bacteria | 1427 |
| 134 | Ga0068302_10050461 | 3300005071 | Bacteria | 2373 |
| 135 | Ga0466726_464370 | 3300042619 | Bacteria | 3902 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13657 | Couple_hipA | HipA N-terminal domain | 5 | 101 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.