Protein Family IF08031
Metagenome
Isolate
489
Members
140
Samples
422
Scaffolds
397.36
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_062997|Ga0466723_062997_10647_12053
- Length
- 468 aa
- Sequence
- MESKKYVSPIHNDGMTSIYLFHIGAVKLYKVFLNVEIIHKKVYIMLRDPLYNVTFADLNNLFFVQNIISMPIISLRGISMPESPIRKLVPLANKAKSEGTKVYHLNIGQPDIPTPEVALDAMRRIDRKILEYGPSEGLLSFRRKLTDYYRKFNILADTEDIIITSGGSEAVNFSFMACLDPGDEIIIPEPAYANYMAFAISCGAVIKTIPSSIEDGFALPPVDKFEALITPKTKAIMICNPNNPTGYLYTREEMNQLRDLVRKYDLFLFSDEVYREFCYTGAPYISAFHLEGIEQNVVLVDSVSKRYSECGIRIGALITKNKQIRENVMKWCQARLSPPLIGQIIAEASLDTSEEYMLSVYNEYLQRRNFLIDRLNRIPGCYSPIPMGAFYTVVRLPVDDADKFCTWCLSDFSYEKQTIMMAPASGFYTAPGHGKNEVRLAYVLNKEELGKALTVLEKALAAYAAIGN
Sample Types
Isolate
13.7%
Metagenome
86.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
22.3%
Termitidae
20.8%
Unclassified
17.7%
Kalotermitidae
11.5%
Armadillidiidae
3.8%
Rhinotermitidae
3.1%
Termopsidae
3.1%
Drosophilidae
2.3%
Culicidae
2.3%
Formicidae
2.3%
Passalidae
1.5%
Apidae
1.5%
Elmidae
1.5%
Daphniidae
1.5%
Hydrophilidae
1.5%
Tenebrionidae
0.8%
Bombycidae
0.8%
Hodotermitidae
0.8%
Nephropidae
0.8%
Taxonomy
Archaea
0
Bacteria
458
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 3 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 4 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 5 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 6 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 7 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 8 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 9 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 10 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 11 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 12 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 13 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 14 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 17 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 18 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 19 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 20 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 21 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 22 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 23 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 24 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 25 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 26 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 27 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 28 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 33 | 2820422691 | Unclassified Firmicutes Lab288P3bin58 | Isolate | Unclassified |
| 34 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 35 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 36 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 37 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 38 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 39 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 40 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 41 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 42 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 43 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 44 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 45 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 46 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 47 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 48 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 49 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 50 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 51 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 52 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 53 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 54 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 55 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 56 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 57 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 58 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 59 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 60 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 61 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 62 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 63 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 64 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 65 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 66 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 67 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 68 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 69 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 70 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 71 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 72 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 73 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 74 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 75 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 76 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 77 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 78 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 79 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 80 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 81 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 82 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 83 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 84 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 85 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 86 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 87 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 88 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 89 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 90 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 91 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 92 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 93 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 94 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 95 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 96 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 97 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 98 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 99 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 100 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 101 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 102 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 103 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 104 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 105 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 106 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 107 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 108 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 109 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 110 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 111 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 112 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 113 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 114 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 115 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 116 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 117 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 118 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 119 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 120 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 121 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 122 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 123 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 124 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 125 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 126 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 127 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 128 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 129 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 130 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 131 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 132 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 133 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 134 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 135 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 136 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 137 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 138 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 139 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 140 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_388680 | 3300042612 | Bacteria | 20042 |
| 2 | Ga0466710_192568 | 3300042613 | Bacteria | 3806 |
| 3 | Ga0466711_360092 | 3300042615 | Bacteria | 22103 |
| 4 | Ga0466715_416370 | 3300042616 | Bacteria | 12372 |
| 5 | Ga0466718_126915 | 3300042617 | Bacteria | 3832 |
| 6 | Ga0466723_000665 | 3300042618 | Bacteria | 17326 |
| 7 | Ga0466723_198718 | 3300042618 | Bacteria | 8915 |
| 8 | Ga0466728_194886 | 3300042620 | Bacteria | 18097 |
| 9 | Ga0466728_197593 | 3300042620 | Bacteria | 2138 |
| 10 | Ga0466728_438356 | 3300042620 | Bacteria | 29481 |
| 11 | Ga0466729_120001 | 3300042621 | Bacteria | 2820 |
| 12 | Ga0466731_192221 | 3300042622 | Bacteria | 60315 |
| 13 | Ga0466735_011630 | 3300042624 | Bacteria | 2170 |
| 14 | Ga0466735_098449 | 3300042624 | Bacteria | 5288 |
| 15 | Ga0466735_203242 | 3300042624 | Bacteria | 13594 |
| 16 | Ga0466730_078430 | 3300042625 | Bacteria | 119933 |
| 17 | Ga0466703_039172 | 3300042636 | Bacteria | 15995 |
| 18 | Ga0466703_043310 | 3300042636 | Bacteria | 10776 |
| 19 | Ga0466703_089495 | 3300042636 | Bacteria | 17498 |
| 20 | Ga0466703_128588 | 3300042636 | Bacteria | 10959 |
| 21 | Ga0466703_164793 | 3300042636 | Unclassified | 3104 |
| 22 | Ga0466703_180202 | 3300042636 | Bacteria | 17308 |
| 23 | Ga0466703_251716 | 3300042636 | Bacteria | 7346 |
| 24 | Ga0466704_221489 | 3300042643 | Bacteria | 4782 |
| 25 | Ga0466704_314588 | 3300042643 | Bacteria | 10061 |
| 26 | Ga0466704_538823 | 3300042643 | Bacteria | 3558 |
| 27 | Ga0466704_582463 | 3300042643 | Bacteria | 5116 |
| 28 | Ga0466708_039780 | 3300042652 | Bacteria | 14623 |
| 29 | Ga0466727_115317 | 3300042655 | Bacteria | 15323 |
| 30 | Ga0466727_203052 | 3300042655 | Bacteria | 14252 |
| 31 | Ga0123355_10057639 | 3300009826 | Bacteria | 6285 |
| 32 | IMNBL1DRAFT_c0000489 | 3300000062 | Bacteria | 33049 |
| 33 | JGI24702J35022_10029076 | 3300002462 | Bacteria | 2966 |
| 34 | Ga0068302_10015968 | 3300005071 | Bacteria | 8084 |
| 35 | Ga0104045_1019357 | 3300007085 | Bacteria | 4925 |
| 36 | Ga0160446_100006 | 3300012835 | Bacteria | 445354 |
| 37 | Ga0160444_104021 | 3300012841 | Bacteria | 2039 |
| 38 | Ga0160433_100621 | 3300012846 | Bacteria | 14455 |
| 39 | Ga0466656_049138 | 3300042550 | Bacteria | 3015 |
| 40 | Ga0466690_252287 | 3300042590 | Bacteria | 2326 |
| 41 | Ga0466690_254897 | 3300042590 | Bacteria | 9553 |
| 42 | Ga0466690_300684 | 3300042590 | Bacteria | 9247 |
| 43 | Ga0466691_055360 | 3300042593 | Bacteria | 60253 |
| 44 | Ga0466691_091184 | 3300042593 | Unclassified | 8392 |
| 45 | Ga0466696_058283 | 3300042596 | Bacteria | 42827 |
| 46 | Ga0466696_112038 | 3300042596 | Bacteria | 14110 |
| 47 | Ga0466706_065618 | 3300042599 | Bacteria | 55553 |
| 48 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 49 | Ga0466706_142693 | 3300042599 | Bacteria | 28316 |
| 50 | Ga0466706_157303 | 3300042599 | Bacteria | 9419 |
| 51 | Ga0466707_249100 | 3300042601 | Bacteria | 8354 |
| 52 | Ga0466713_102907 | 3300042602 | Bacteria | 38987 |
| 53 | Ga0466714_044872 | 3300042603 | Bacteria | 2721 |
| 54 | Ga0466716_380648 | 3300042605 | Bacteria | 32232 |
| 55 | Ga0466722_033284 | 3300042609 | Bacteria | 7519 |
| 56 | Ga0466722_039144 | 3300042609 | Bacteria | 9343 |
| 57 | Ga0466705_072470 | 3300042612 | Unclassified | 1673 |
| 58 | Ga0466705_305905 | 3300042612 | Unclassified | 1487 |
| 59 | Ga0466732_337220 | 3300042656 | Bacteria | 3596 |
| 60 | Ga0466711_184585 | 3300042615 | Bacteria | 17024 |
| 61 | Ga0466711_281547 | 3300042615 | Bacteria | 3568 |
| 62 | Ga0466711_455972 | 3300042615 | Bacteria | 4129 |
| 63 | Ga0466715_393017 | 3300042616 | Bacteria | 5181 |
| 64 | Ga0466723_026931 | 3300042618 | Bacteria | 5608 |
| 65 | Ga0466723_193771 | 3300042618 | Bacteria | 7591 |
| 66 | Ga0466726_046002 | 3300042619 | Bacteria | 3327 |
| 67 | Ga0466726_075359 | 3300042619 | Bacteria | 5717 |
| 68 | Ga0466728_137546 | 3300042620 | Bacteria | 2388 |
| 69 | Ga0466703_098553 | 3300042636 | Bacteria | 10370 |
| 70 | Ga0466703_373450 | 3300042636 | Bacteria | 3787 |
| 71 | Ga0466704_006994 | 3300042643 | Unclassified | 5392 |
| 72 | Ga0466704_044023 | 3300042643 | Bacteria | 26668 |
| 73 | Ga0466704_083882 | 3300042643 | Bacteria | 3948 |
| 74 | Ga0466704_481025 | 3300042643 | Bacteria | 3763 |
| 75 | Ga0466709_128330 | 3300042648 | Bacteria | 36952 |
| 76 | Ga0466708_024546 | 3300042652 | Bacteria | 37398 |
| 77 | Ga0466727_102378 | 3300042655 | Bacteria | 9872 |
| 78 | Ga0123353_10107753 | 3300010167 | Bacteria | 4490 |
| 79 | Ga0123353_10480215 | 3300010167 | Bacteria | 1819 |
| 80 | Ga0123354_10257118 | 3300010882 | Bacteria | 1753 |
| 81 | IMNBL1DRAFT_c0019126 | 3300000062 | Unclassified | 2818 |
| 82 | JGI24695J34938_10003014 | 3300002450 | Bacteria | 12104 |
| 83 | JGI24702J35022_10000076 | 3300002462 | Bacteria | 43662 |
| 84 | JGI24702J35022_10035365 | 3300002462 | Bacteria | 2671 |
| 85 | JGI24699J35502_11134091 | 3300002509 | Bacteria | 29759 |
| 86 | Ga0103267_1000122 | 3300007190 | Bacteria | 29626 |
| 87 | Ga0103268_1000130 | 3300007192 | Bacteria | 31207 |
| 88 | Ga0160472_100269 | 3300012839 | Bacteria | 57873 |
| 89 | Ga0160445_101124 | 3300012847 | Unclassified | 8441 |
| 90 | Ga0160457_1000737 | 3300012858 | Bacteria | 12120 |
| 91 | Ga0466657_053151 | 3300042582 | Bacteria | 21959 |
| 92 | Ga0466690_003105 | 3300042590 | Bacteria | 52820 |
| 93 | Ga0466690_052009 | 3300042590 | Bacteria | 6506 |
| 94 | Ga0466690_306059 | 3300042590 | Bacteria | 9606 |
| 95 | Ga0466690_354901 | 3300042590 | Bacteria | 2900 |
| 96 | Ga0466696_330342 | 3300042596 | Bacteria | 3679 |
| 97 | Ga0466706_108336 | 3300042599 | Bacteria | 3770 |
| 98 | Ga0466706_165119 | 3300042599 | Bacteria | 66110 |
| 99 | Ga0466707_337609 | 3300042601 | Bacteria | 5314 |
| 100 | Ga0466713_079736 | 3300042602 | Bacteria | 32873 |
| 101 | Ga0466716_277981 | 3300042605 | Unclassified | 7419 |
| 102 | Ga0466719_179756 | 3300042606 | Bacteria | 9015 |
| 103 | Ga0466719_266389 | 3300042606 | Bacteria | 7558 |
| 104 | Ga0466719_387244 | 3300042606 | Bacteria | 3638 |
| 105 | Ga0466719_469665 | 3300042606 | Bacteria | 1473 |
| 106 | Ga0466720_055133 | 3300042607 | Bacteria | 1199 |
| 107 | Ga0466722_028721 | 3300042609 | Bacteria | 19694 |
| 108 | Ga0466722_265629 | 3300042609 | Unclassified | 1965 |
| 109 | Ga0466705_082470 | 3300042612 | Bacteria | 11144 |
| 110 | Ga0466705_113757 | 3300042612 | Unclassified | 2411 |
| 111 | Ga0466705_347982 | 3300042612 | Bacteria | 27347 |
| 112 | Ga0466733_041299 | 3300042659 | Bacteria | 4388 |
| 113 | Ga0466733_101407 | 3300042659 | Bacteria | 3300 |
| 114 | Ga0466711_387645 | 3300042615 | Bacteria | 5333 |
| 115 | Ga0466715_293993 | 3300042616 | Bacteria | 36306 |
| 116 | Ga0466726_121072 | 3300042619 | Unclassified | 6251 |
| 117 | Ga0466726_486830 | 3300042619 | Bacteria | 1435 |
| 118 | Ga0466728_051744 | 3300042620 | Bacteria | 107334 |
| 119 | Ga0466728_056752 | 3300042620 | Bacteria | 16177 |
| 120 | Ga0466703_038560 | 3300042636 | Bacteria | 5038 |
| 121 | Ga0466703_221306 | 3300042636 | Bacteria | 5560 |
| 122 | Ga0466703_348714 | 3300042636 | Bacteria | 36764 |
| 123 | Ga0466709_201262 | 3300042648 | Bacteria | 3425 |
| 124 | Ga0466709_331332 | 3300042648 | Bacteria | 8322 |
| 125 | Ga0466709_398029 | 3300042648 | Bacteria | 84534 |
| 126 | Ga0466708_076108 | 3300042652 | Bacteria | 112124 |
| 127 | Ga0466708_199084 | 3300042652 | Bacteria | 26975 |
| 128 | Ga0466708_396420 | 3300042652 | Bacteria | 5157 |
| 129 | Ga0466725_239082 | 3300042654 | Bacteria | 1975 |
| 130 | Ga0466727_028082 | 3300042655 | Bacteria | 5878 |
| 131 | Ga0466727_032632 | 3300042655 | Bacteria | 4574 |
| 132 | Ga0123356_10235966 | 3300010049 | Bacteria | 1896 |
| 133 | Ga0123353_10007690 | 3300010167 | Bacteria | 14612 |
| 134 | IMNBL1DRAFT_c0001758 | 3300000062 | Bacteria | 15875 |
| 135 | JGI24702J35022_10007431 | 3300002462 | Bacteria | 6283 |
| 136 | JGI24702J35022_10027893 | 3300002462 | Bacteria | 3037 |
| 137 | JGI24705J35276_12231792 | 3300002504 | Bacteria | 4069 |
| 138 | Ga0068302_10044797 | 3300005071 | Bacteria | 1587 |
| 139 | Ga0104048_1025223 | 3300007143 | Bacteria | 5192 |
| 140 | Ga0160469_100595 | 3300012824 | Unclassified | 14667 |
| 141 | Ga0466690_080800 | 3300042590 | Bacteria | 6544 |
| 142 | Ga0466690_305061 | 3300042590 | Bacteria | 2271 |
| 143 | Ga0466692_063390 | 3300042591 | Bacteria | 95171 |
| 144 | Ga0466693_103042 | 3300042592 | Bacteria | 1802 |
| 145 | Ga0466691_062506 | 3300042593 | Bacteria | 9669 |
| 146 | Ga0466691_183677 | 3300042593 | Bacteria | 8747 |
| 147 | Ga0466695_397593 | 3300042595 | Bacteria | 9894 |
| 148 | Ga0466696_022797 | 3300042596 | Bacteria | 4420 |
| 149 | Ga0466696_059254 | 3300042596 | Bacteria | 20606 |
| 150 | Ga0466696_069450 | 3300042596 | Bacteria | 21498 |
| 151 | Ga0466696_168668 | 3300042596 | Bacteria | 4219 |
| 152 | Ga0466696_189764 | 3300042596 | Bacteria | 19845 |
| 153 | Ga0466696_239834 | 3300042596 | Bacteria | 4013 |
| 154 | Ga0466696_348292 | 3300042596 | Bacteria | 10802 |
| 155 | Ga0466701_027626 | 3300042598 | Bacteria | 70830 |
| 156 | Ga0466701_096830 | 3300042598 | Bacteria | 1981 |
| 157 | Ga0466700_421850 | 3300042600 | Bacteria | 2031 |
| 158 | Ga0466707_034226 | 3300042601 | Bacteria | 7181 |
| 159 | Ga0466707_090907 | 3300042601 | Bacteria | 18537 |
| 160 | Ga0466713_063067 | 3300042602 | Bacteria | 116971 |
| 161 | Ga0466713_067161 | 3300042602 | Bacteria | 44941 |
| 162 | Ga0466714_019543 | 3300042603 | Bacteria | 3439 |
| 163 | Ga0466714_157490 | 3300042603 | Bacteria | 1693 |
| 164 | Ga0466716_130562 | 3300042605 | Bacteria | 9764 |
| 165 | Ga0466716_161076 | 3300042605 | Bacteria | 7400 |
| 166 | Ga0466719_212406 | 3300042606 | Bacteria | 15061 |
| 167 | Ga0466719_440966 | 3300042606 | Bacteria | 7076 |
| 168 | Ga0466722_003863 | 3300042609 | Bacteria | 15365 |
| 169 | Ga0466722_055125 | 3300042609 | Bacteria | 10250 |
| 170 | Ga0466697_168887 | 3300042611 | Bacteria | 9525 |
| 171 | Ga0466705_052888 | 3300042612 | Bacteria | 11461 |
| 172 | Ga0466705_086162 | 3300042612 | Bacteria | 5167 |
| 173 | Ga0466705_260940 | 3300042612 | Bacteria | 4845 |
| 174 | Ga0466705_303703 | 3300042612 | Bacteria | 5594 |
| 175 | Ga0466733_100528 | 3300042659 | Bacteria | 10041 |
| 176 | Ga0466733_149506 | 3300042659 | Bacteria | 259198 |
| 177 | Ga0466710_209117 | 3300042613 | Bacteria | 2240 |
| 178 | Ga0466711_021664 | 3300042615 | Bacteria | 63823 |
| 179 | Ga0466711_059517 | 3300042615 | Bacteria | 5248 |
| 180 | Ga0466711_348580 | 3300042615 | Bacteria | 3931 |
| 181 | Ga0466715_060283 | 3300042616 | Bacteria | 23431 |
| 182 | Ga0466715_238456 | 3300042616 | Bacteria | 5284 |
| 183 | Ga0466715_291238 | 3300042616 | Bacteria | 5923 |
| 184 | Ga0466723_009637 | 3300042618 | Bacteria | 1951 |
| 185 | Ga0466723_072065 | 3300042618 | Bacteria | 25909 |
| 186 | Ga0466723_084108 | 3300042618 | Bacteria | 1959 |
| 187 | Ga0466726_048383 | 3300042619 | Bacteria | 29520 |
| 188 | Ga0466728_060956 | 3300042620 | Bacteria | 13361 |
| 189 | Ga0466728_301439 | 3300042620 | Bacteria | 14764 |
| 190 | Ga0466735_034042 | 3300042624 | Bacteria | 8965 |
| 191 | Ga0466704_067334 | 3300042643 | Bacteria | 14559 |
| 192 | Ga0466709_205431 | 3300042648 | Unclassified | 12100 |
| 193 | Ga0466709_239174 | 3300042648 | Bacteria | 3561 |
| 194 | Ga0466709_269092 | 3300042648 | Unclassified | 15806 |
| 195 | Ga0466727_334420 | 3300042655 | Bacteria | 19173 |
| 196 | Ga0123353_10000488 | 3300010167 | Bacteria | 48967 |
| 197 | Ga0123354_10109563 | 3300010882 | Bacteria | 3657 |
| 198 | 2227663506 | 2225789004 | Bacteria | 10430 |
| 199 | IMNBL1DRAFT_c0009144 | 3300000062 | Bacteria | 4939 |
| 200 | JGI24702J35022_10009107 | 3300002462 | Bacteria | 5591 |
| 201 | Ga0104045_1003508 | 3300007085 | Bacteria | 29645 |
| 202 | Ga0103267_1000040 | 3300007190 | Bacteria | 62503 |
| 203 | Ga0160433_100018 | 3300012846 | Bacteria | 213431 |
| 204 | Ga0466690_335590 | 3300042590 | Bacteria | 22756 |
| 205 | Ga0466692_205037 | 3300042591 | Bacteria | 4929 |
| 206 | Ga0466691_132182 | 3300042593 | Bacteria | 5699 |
| 207 | Ga0466691_204797 | 3300042593 | Bacteria | 11035 |
| 208 | Ga0466696_278999 | 3300042596 | Bacteria | 3831 |
| 209 | Ga0466696_344957 | 3300042596 | Bacteria | 38008 |
| 210 | Ga0466701_074772 | 3300042598 | Bacteria | 7076 |
| 211 | Ga0466706_114300 | 3300042599 | Bacteria | 35982 |
| 212 | Ga0466706_177112 | 3300042599 | Bacteria | 5712 |
| 213 | Ga0466700_110038 | 3300042600 | Bacteria | 3912 |
| 214 | Ga0466713_010169 | 3300042602 | Bacteria | 25360 |
| 215 | Ga0466713_057843 | 3300042602 | Unclassified | 10746 |
| 216 | Ga0466713_115244 | 3300042602 | Bacteria | 27943 |
| 217 | Ga0466714_154128 | 3300042603 | Bacteria | 4631 |
| 218 | Ga0466716_027631 | 3300042605 | Bacteria | 9580 |
| 219 | Ga0466716_375555 | 3300042605 | Bacteria | 3937 |
| 220 | Ga0466722_028185 | 3300042609 | Bacteria | 38347 |
| 221 | Ga0466722_188734 | 3300042609 | Bacteria | 1919 |
| 222 | Ga0466697_064907 | 3300042611 | Bacteria | 2106 |
| 223 | Ga0466705_009785 | 3300042612 | Unclassified | 4498 |
| 224 | Ga0466705_205398 | 3300042612 | Bacteria | 5105 |
| 225 | Ga0466733_146754 | 3300042659 | Bacteria | 9243 |
| 226 | Ga0466733_191183 | 3300042659 | Bacteria | 11165 |
| 227 | Ga0466733_213005 | 3300042659 | Bacteria | 19386 |
| 228 | Ga0466715_228308 | 3300042616 | Bacteria | 11596 |
| 229 | Ga0466723_062997 | 3300042618 | Bacteria | 17588 |
| 230 | Ga0466723_153709 | 3300042618 | Bacteria | 20208 |
| 231 | Ga0466723_361717 | 3300042618 | Bacteria | 9983 |
| 232 | Ga0466726_415059 | 3300042619 | Bacteria | 7352 |
| 233 | Ga0466730_062868 | 3300042625 | Bacteria | 5018 |
| 234 | Ga0466703_092574 | 3300042636 | Bacteria | 2825 |
| 235 | Ga0466703_350435 | 3300042636 | Unclassified | 1677 |
| 236 | Ga0466703_367756 | 3300042636 | Bacteria | 6528 |
| 237 | Ga0466704_235614 | 3300042643 | Unclassified | 8836 |
| 238 | Ga0466709_231727 | 3300042648 | Bacteria | 7628 |
| 239 | Ga0466724_38378 | 3300042649 | Unclassified | 6836 |
| 240 | Ga0466708_185704 | 3300042652 | Bacteria | 2934 |
| 241 | Ga0123356_10034795 | 3300010049 | Bacteria | 4707 |
| 242 | Ga0123353_10011555 | 3300010167 | Bacteria | 12457 |
| 243 | IMNBL1DRAFT_c0002165 | 3300000062 | Bacteria | 13902 |
| 244 | JGI24702J35022_10017328 | 3300002462 | Bacteria | 3937 |
| 245 | Ga0104048_1003242 | 3300007143 | Unclassified | 4533 |
| 246 | Ga0466690_005231 | 3300042590 | Bacteria | 13066 |
| 247 | Ga0466690_113885 | 3300042590 | Bacteria | 10082 |
| 248 | Ga0466690_419708 | 3300042590 | Unclassified | 7533 |
| 249 | Ga0466692_158853 | 3300042591 | Bacteria | 9992 |
| 250 | Ga0466691_057389 | 3300042593 | Bacteria | 24650 |
| 251 | Ga0466691_118657 | 3300042593 | Bacteria | 2691 |
| 252 | Ga0466696_027251 | 3300042596 | Bacteria | 21143 |
| 253 | Ga0466699_390671 | 3300042597 | Bacteria | 1427 |
| 254 | Ga0466701_026348 | 3300042598 | Bacteria | 2668 |
| 255 | Ga0466701_099197 | 3300042598 | Bacteria | 41467 |
| 256 | Ga0466706_093539 | 3300042599 | Bacteria | 51974 |
| 257 | Ga0466706_143808 | 3300042599 | Bacteria | 3139 |
| 258 | Ga0466706_181171 | 3300042599 | Bacteria | 18884 |
| 259 | Ga0466707_363103 | 3300042601 | Bacteria | 6967 |
| 260 | Ga0466713_070338 | 3300042602 | Bacteria | 49717 |
| 261 | Ga0466714_127121 | 3300042603 | Bacteria | 69480 |
| 262 | Ga0466716_005194 | 3300042605 | Bacteria | 2300 |
| 263 | Ga0466719_445650 | 3300042606 | Bacteria | 3956 |
| 264 | Ga0466705_076385 | 3300042612 | Unclassified | 5404 |
| 265 | Ga0466733_165139 | 3300042659 | Bacteria | 6153 |
| 266 | Ga0466711_034746 | 3300042615 | Bacteria | 6352 |
| 267 | Ga0466711_142284 | 3300042615 | Unclassified | 4413 |
| 268 | Ga0466711_157835 | 3300042615 | Bacteria | 4518 |
| 269 | Ga0466711_224658 | 3300042615 | Bacteria | 3203 |
| 270 | Ga0466715_156743 | 3300042616 | Bacteria | 11200 |
| 271 | Ga0466715_195053 | 3300042616 | Bacteria | 9423 |
| 272 | Ga0466723_068620 | 3300042618 | Bacteria | 26399 |
| 273 | Ga0466723_092780 | 3300042618 | Bacteria | 3787 |
| 274 | Ga0466726_052164 | 3300042619 | Bacteria | 5337 |
| 275 | Ga0466728_079698 | 3300042620 | Bacteria | 13319 |
| 276 | Ga0466731_219233 | 3300042622 | Bacteria | 2234 |
| 277 | Ga0466735_023145 | 3300042624 | Bacteria | 2341 |
| 278 | Ga0466735_100673 | 3300042624 | Bacteria | 3894 |
| 279 | Ga0466735_111779 | 3300042624 | Bacteria | 5790 |
| 280 | Ga0466703_127664 | 3300042636 | Bacteria | 2586 |
| 281 | Ga0466704_013858 | 3300042643 | Bacteria | 11133 |
| 282 | Ga0466704_060468 | 3300042643 | Bacteria | 12140 |
| 283 | Ga0466709_333660 | 3300042648 | Bacteria | 12307 |
| 284 | Ga0466708_219414 | 3300042652 | Bacteria | 8051 |
| 285 | Ga0466727_096744 | 3300042655 | Bacteria | 22066 |
| 286 | Ga0466727_100832 | 3300042655 | Bacteria | 5675 |
| 287 | Ga0466727_241416 | 3300042655 | Bacteria | 5368 |
| 288 | Ga0123353_10000989 | 3300010167 | Bacteria | 34868 |
| 289 | Ga0123353_10316552 | 3300010167 | Bacteria | 2371 |
| 290 | IMNBL1DRAFT_c0000139 | 3300000062 | Bacteria | 64680 |
| 291 | IMNBL1DRAFT_c0000212 | 3300000062 | Bacteria | 50986 |
| 292 | IMNBL1DRAFT_c0044655 | 3300000062 | Bacteria | 1454 |
| 293 | CVPL010W_10000427 | 3300002931 | Bacteria | 59397 |
| 294 | Ga0068302_10040019 | 3300005071 | Unclassified | 1490 |
| 295 | Ga0160441_100123 | 3300012825 | Bacteria | 88854 |
| 296 | Ga0466657_091042 | 3300042582 | Bacteria | 15882 |
| 297 | Ga0466690_040521 | 3300042590 | Bacteria | 3279 |
| 298 | Ga0466690_379886 | 3300042590 | Bacteria | 10468 |
| 299 | Ga0466691_028936 | 3300042593 | Bacteria | 12625 |
| 300 | Ga0466696_139742 | 3300042596 | Bacteria | 8436 |
| 301 | Ga0466696_505776 | 3300042596 | Bacteria | 4265 |
| 302 | Ga0466706_141591 | 3300042599 | Bacteria | 7556 |
| 303 | Ga0466700_225201 | 3300042600 | Bacteria | 9332 |
| 304 | Ga0466707_276777 | 3300042601 | Bacteria | 7753 |
| 305 | Ga0466707_396626 | 3300042601 | Bacteria | 7136 |
| 306 | Ga0466713_043488 | 3300042602 | Bacteria | 14858 |
| 307 | Ga0466714_122466 | 3300042603 | Bacteria | 168454 |
| 308 | Ga0466716_285995 | 3300042605 | Bacteria | 19976 |
| 309 | Ga0466716_338415 | 3300042605 | Bacteria | 3338 |
| 310 | Ga0466722_134411 | 3300042609 | Bacteria | 6983 |
| 311 | Ga0466722_178216 | 3300042609 | Bacteria | 13002 |
| 312 | Ga0466705_024319 | 3300042612 | Bacteria | 12627 |
| 313 | Ga0466705_125425 | 3300042612 | Bacteria | 8046 |
| 314 | Ga0466733_091635 | 3300042659 | Bacteria | 7031 |
| 315 | Ga0466733_152906 | 3300042659 | Bacteria | 2323 |
| 316 | Ga0466711_156292 | 3300042615 | Bacteria | 4223 |
| 317 | Ga0466711_283875 | 3300042615 | Bacteria | 6984 |
| 318 | Ga0466715_207507 | 3300042616 | Bacteria | 3561 |
| 319 | Ga0466715_642553 | 3300042616 | Bacteria | 44089 |
| 320 | Ga0466723_088569 | 3300042618 | Bacteria | 17877 |
| 321 | Ga0466723_199512 | 3300042618 | Bacteria | 25184 |
| 322 | Ga0466723_238466 | 3300042618 | Bacteria | 9436 |
| 323 | Ga0466726_100737 | 3300042619 | Bacteria | 16180 |
| 324 | Ga0466726_230828 | 3300042619 | Bacteria | 3386 |
| 325 | Ga0466728_133470 | 3300042620 | Bacteria | 14287 |
| 326 | Ga0466728_180564 | 3300042620 | Bacteria | 92308 |
| 327 | Ga0466729_253684 | 3300042621 | Bacteria | 8951 |
| 328 | Ga0466729_303314 | 3300042621 | Bacteria | 7703 |
| 329 | Ga0466735_214237 | 3300042624 | Bacteria | 6066 |
| 330 | Ga0466703_146869 | 3300042636 | Bacteria | 11356 |
| 331 | Ga0466703_165805 | 3300042636 | Bacteria | 12405 |
| 332 | Ga0466704_319284 | 3300042643 | Bacteria | 6348 |
| 333 | Ga0466704_343619 | 3300042643 | Bacteria | 23042 |
| 334 | Ga0466708_176956 | 3300042652 | Bacteria | 1595 |
| 335 | Ga0466708_259041 | 3300042652 | Bacteria | 17584 |
| 336 | Ga0466708_413824 | 3300042652 | Bacteria | 7937 |
| 337 | Ga0123357_10190069 | 3300009784 | Bacteria | 2368 |
| 338 | Ga0160465_100019 | 3300012803 | Bacteria | 275855 |
| 339 | 2227513524 | 2225789004 | Bacteria | 18108 |
| 340 | 2227591272 | 2225789004 | Bacteria | 49846 |
| 341 | IMNBL1DRAFT_c0008903 | 3300000062 | Bacteria | 5048 |
| 342 | Ga0068305_10080139 | 3300005083 | Bacteria | 9327 |
| 343 | Ga0104045_1019785 | 3300007085 | Bacteria | 2866 |
| 344 | Ga0103267_1000234 | 3300007190 | Bacteria | 52769 |
| 345 | Ga0160432_100004 | 3300012818 | Bacteria | 604772 |
| 346 | Ga0160469_100025 | 3300012824 | Bacteria | 304366 |
| 347 | Ga0160430_101064 | 3300012852 | Bacteria | 11437 |
| 348 | Ga0466693_167676 | 3300042592 | Bacteria | 1743 |
| 349 | Ga0466691_056039 | 3300042593 | Bacteria | 16030 |
| 350 | Ga0466691_099372 | 3300042593 | Bacteria | 2463 |
| 351 | Ga0466696_057806 | 3300042596 | Unclassified | 3885 |
| 352 | Ga0466696_325258 | 3300042596 | Bacteria | 15299 |
| 353 | Ga0466696_387056 | 3300042596 | Bacteria | 4590 |
| 354 | Ga0466699_126667 | 3300042597 | Bacteria | 1447 |
| 355 | Ga0466701_023671 | 3300042598 | Bacteria | 5393 |
| 356 | Ga0466706_011910 | 3300042599 | Bacteria | 39915 |
| 357 | Ga0466706_019627 | 3300042599 | Bacteria | 82703 |
| 358 | Ga0466706_021000 | 3300042599 | Bacteria | 7448 |
| 359 | Ga0466706_022534 | 3300042599 | Bacteria | 19846 |
| 360 | Ga0466706_096832 | 3300042599 | Bacteria | 6410 |
| 361 | Ga0466707_091027 | 3300042601 | Bacteria | 5125 |
| 362 | Ga0466713_093750 | 3300042602 | Bacteria | 2466 |
| 363 | Ga0466714_104674 | 3300042603 | Bacteria | 2547 |
| 364 | Ga0466714_126469 | 3300042603 | Bacteria | 66148 |
| 365 | Ga0466714_141406 | 3300042603 | Bacteria | 19688 |
| 366 | Ga0466716_162562 | 3300042605 | Unclassified | 2413 |
| 367 | Ga0466722_009368 | 3300042609 | Bacteria | 5359 |
| 368 | Ga0466722_225951 | 3300042609 | Bacteria | 10946 |
| 369 | Ga0466705_055100 | 3300042612 | Bacteria | 30547 |
| 370 | Ga0466705_083789 | 3300042612 | Bacteria | 4602 |
| 371 | Ga0466705_262134 | 3300042612 | Unclassified | 3012 |
| 372 | Ga0466732_173901 | 3300042656 | Bacteria | 1651 |
| 373 | Ga0466733_106246 | 3300042659 | Bacteria | 308825 |
| 374 | Ga0466710_027636 | 3300042613 | Bacteria | 1519 |
| 375 | Ga0466711_161015 | 3300042615 | Bacteria | 15181 |
| 376 | Ga0466715_079603 | 3300042616 | Bacteria | 222305 |
| 377 | Ga0466715_231386 | 3300042616 | Bacteria | 80319 |
| 378 | Ga0466715_518629 | 3300042616 | Bacteria | 18977 |
| 379 | Ga0466715_588780 | 3300042616 | Bacteria | 24802 |
| 380 | Ga0466726_074714 | 3300042619 | Bacteria | 3247 |
| 381 | Ga0466735_224189 | 3300042624 | Bacteria | 3664 |
| 382 | Ga0466703_044194 | 3300042636 | Bacteria | 7844 |
| 383 | Ga0466703_091553 | 3300042636 | Bacteria | 6292 |
| 384 | Ga0466703_163108 | 3300042636 | Bacteria | 4269 |
| 385 | Ga0466703_400896 | 3300042636 | Bacteria | 22375 |
| 386 | Ga0466704_018023 | 3300042643 | Bacteria | 1427 |
| 387 | Ga0466704_326796 | 3300042643 | Bacteria | 7022 |
| 388 | Ga0466704_447061 | 3300042643 | Bacteria | 9844 |
| 389 | Ga0466708_126428 | 3300042652 | Bacteria | 7382 |
| 390 | Ga0466725_035263 | 3300042654 | Bacteria | 13140 |
| 391 | Ga0466727_090895 | 3300042655 | Bacteria | 19830 |
| 392 | Ga0123353_10003827 | 3300010167 | Bacteria | 19195 |
| 393 | Ga0123353_10008703 | 3300010167 | Bacteria | 13891 |
| 394 | Ga0123354_10001987 | 3300010882 | Bacteria | 26220 |
| 395 | Ga0123354_10245284 | 3300010882 | Bacteria | 1831 |
| 396 | Ga0160471_100001 | 3300012812 | Bacteria | 914646 |
| 397 | IMNBL1DRAFT_c0002176 | 3300000062 | Bacteria | 13841 |
| 398 | JGI24702J35022_10026470 | 3300002462 | Unclassified | 3124 |
| 399 | Ga0104045_1006096 | 3300007085 | Bacteria | 3281 |
| 400 | Ga0104048_1005548 | 3300007143 | Unclassified | 3273 |
| 401 | Ga0104050_1003511 | 3300007153 | Bacteria | 7289 |
| 402 | Ga0160433_100530 | 3300012846 | Unclassified | 17456 |
| 403 | Ga0265387_1001762 | 3300024582 | Bacteria | 3100 |
| 404 | Ga0466657_091901 | 3300042582 | Bacteria | 18124 |
| 405 | Ga0466690_059534 | 3300042590 | Bacteria | 7356 |
| 406 | Ga0466690_314901 | 3300042590 | Bacteria | 10181 |
| 407 | Ga0466692_008187 | 3300042591 | Bacteria | 121981 |
| 408 | Ga0466691_013384 | 3300042593 | Bacteria | 53078 |
| 409 | Ga0466691_127025 | 3300042593 | Bacteria | 45490 |
| 410 | Ga0466696_078657 | 3300042596 | Bacteria | 5860 |
| 411 | Ga0466696_149835 | 3300042596 | Bacteria | 3904 |
| 412 | Ga0466696_188282 | 3300042596 | Unclassified | 2740 |
| 413 | Ga0466701_080575 | 3300042598 | Bacteria | 14163 |
| 414 | Ga0466706_063233 | 3300042599 | Bacteria | 14068 |
| 415 | Ga0466707_179989 | 3300042601 | Bacteria | 30155 |
| 416 | Ga0466714_038526 | 3300042603 | Bacteria | 5867 |
| 417 | Ga0466714_113742 | 3300042603 | Bacteria | 44490 |
| 418 | Ga0466714_168297 | 3300042603 | Bacteria | 3630 |
| 419 | Ga0466716_133554 | 3300042605 | Bacteria | 1650 |
| 420 | Ga0466719_198649 | 3300042606 | Bacteria | 3946 |
| 421 | Ga0466722_068893 | 3300042609 | Bacteria | 40868 |
| 422 | Ga0466722_219869 | 3300042609 | Bacteria | 1418 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.