Protein Family IF07927

Metagenome Metatranscriptome Isolate
710 Members
223 Samples
560 Scaffolds
529.29 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_086476|Ga0466718_086476_5247_6989
Length
580 aa
Sequence
LFLLFYKAYWQLPGKQEVRDGCCLIGCGSEIGKQGRPNAVKKYKRQKAMDIKQAIIENKTFLGIELGSTRIKAVLIGENYAPIAAGSHDWENRLEDGIWTYHLDDVWAGLQNCFRNLALDVETRYGLTLSSVGAIGISAMMHGYLVFDKNGEQLVPFRTWRNTTTEKAAALLTEKFKFNIPQRWSIAHLYQAVLNGEPHVKNIDYITTLAGYVHWKLTGRRTLGIGDASGMFPVDNGNYNSLMLKQFDELAAQYNYDRKIAGILPAVLNAGEDAGTLTEQGAKLLDSSGCLRNGIPFCPPEGDAGTGMAATNSVAERTGNVSAGTSIFAMIVMEKELSKVYPEIDIVTTPAGKPVAMVHCNNCTSDIDAWIKLFRELLDISGAKMDKAALYDALYYKIPEADKDCGGLFSCNYYSGETITGIEEGRPLFARLPDSNFTLANFMRTLLFSSMGTLKYGIDILTEKEKVRIDSLLGHGGLFKTKGVGQRFMAAVFNAPVSVMESAGEGGAWGIALLAAFMLQKGVTLEKFLAEKVFAGKTGAQIEPDPKDVESFGKFMKCYTAGLKIERAAVENMKRGDYEP

πŸ“Š Sample Types

Isolate 21.1%
Metagenome 78.7%
MAG 0.0%
Metatranscriptome 0.1%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 38.0%
Termitidae 19.2%
Apidae 15.5%
Drosophilidae 8.9%
Kalotermitidae 7.0%
Tenebrionidae 3.3%
Rhinotermitidae 1.9%
Scarabaeidae 1.9%
Termopsidae 1.4%
Passalidae 0.9%
Hodotermitidae 0.5%
Libellulidae 0.5%
Blaberidae 0.5%
Hydrophilidae 0.5%

🌳 Taxonomy

Archaea 3
Bacteria 696
Eukaryota 0
Viruses 0
Unclassified 11

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
2 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
3 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
4 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
5 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
6 2590828839 Clostridium sp. 1 Isolate Termitidae
7 2595698193 Melissococcus plutonius B5 Isolate Apidae
8 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
9 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
10 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
11 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
12 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
13 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
14 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
17 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
18 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
19 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
20 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
21 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
22 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
23 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
24 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
25 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
33 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
34 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 2820820509 Unclassified Actinobacteria Nt197P3bin23 Isolate Unclassified
37 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
38 2595698198 Melissococcus plutonius L9 Isolate Apidae
39 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
40 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
41 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
42 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
43 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
44 2820630457 Unclassified Firmicutes Emb289P1bin119 Isolate Unclassified
45 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
46 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
47 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
48 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
49 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
50 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
51 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
52 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
53 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
54 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
55 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
56 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
57 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
58 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
59 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
60 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
61 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
62 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
63 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
64 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
65 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
66 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
67 2590828840 Clostridium sp. 2 Isolate Termitidae
68 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
69 2595698199 Melissococcus plutonius 60 Isolate Apidae
70 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
71 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
72 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
73 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
74 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
75 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
76 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
77 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
78 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
79 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
80 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
81 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
82 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
83 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
84 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
85 8007237282 Enterococcus sp. DIV0212c Isolate
86 8017489919 Lactobacillus brevis EF Isolate Unclassified
87 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
88 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
89 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
90 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
91 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
92 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
93 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
94 2931430189 Tessaracoccus palaemonis J1M15 Isolate
95 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
96 2820946191 Unclassified Acidobacteria Nt197P3bin31 Isolate Unclassified
97 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
98 2595698197 Melissococcus plutonius H6 Isolate Apidae
99 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
100 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
101 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
102 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
103 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
104 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
105 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
106 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
107 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
108 2820342392 Unclassified Firmicutes Nt197P3bin64 Isolate Unclassified
109 2820702360 Unclassified Firmicutes Co191P1bin4 Isolate Unclassified
110 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
111 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
112 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
113 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
114 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
115 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
116 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
117 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
118 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
119 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
120 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
121 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
122 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
123 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
124 2593339125 Clostridium sp. 5 Isolate Termitidae
125 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
126 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
127 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
128 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
129 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
130 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
131 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
132 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
133 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
134 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
135 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
136 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
137 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
138 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
139 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
140 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
141 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
142 8012942269 Mammaliicoccus lentus UD i2 Isolate Tenebrionidae
143 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
144 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
145 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
146 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
147 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
148 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
149 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
150 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
151 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
152 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
153 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
154 2595698195 Melissococcus plutonius 119 Isolate Apidae
155 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
156 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
157 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
158 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
159 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
160 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
161 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
162 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
163 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
164 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
165 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
166 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
167 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
168 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
169 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
170 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
171 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
172 2820809073 Unclassified Actinobacteria Nt197P3bin55 Isolate Unclassified
173 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
174 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
175 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
176 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
177 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
178 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
179 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
180 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
181 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
182 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
183 2772190975 Treponema sp. RmG30 Isolate Blaberidae
184 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
185 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
186 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
187 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
188 2802429577 Bifidobacterium indicum DSM 20214 Isolate Unclassified
189 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
190 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
191 2820329821 Unclassified Firmicutes Nt197P3bin77 Isolate Unclassified
192 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
193 2820382897 Unclassified Firmicutes Nt197P1bin3 Isolate Unclassified
194 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
195 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
196 2627853628 Melissococcus plutonius 82 Isolate Apidae
197 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
198 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
199 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
200 2873603790 Tessaracoccus coleopterorum HDW20 Isolate Hydrophilidae
201 2568526170 Bifidobacterium sp. A11 Isolate Apidae
202 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
203 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
204 2740892557 Staphylococcus sp. JDR108L-110-1 Isolate Unclassified
205 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
206 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
207 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
208 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
209 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
210 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
211 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
212 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
213 2820615445 Unclassified Firmicutes Emb289P1bin132 Isolate Unclassified
214 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
215 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
216 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
217 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
218 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
219 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
220 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
221 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
222 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
223 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10226707 3300009784 Bacteria 2059
2 Ga0123356_10006147 3300010049 Bacteria 12176
3 Ga0123356_10009646 3300010049 Bacteria 9524
4 Ga0123356_10022051 3300010049 Bacteria 6014
5 Ga0123356_10057265 3300010049 Bacteria 3632
6 Ga0123353_10027228 3300010167 Bacteria 8756
7 Ga0123353_10034644 3300010167 Bacteria 7885
8 Ga0123353_10035919 3300010167 Bacteria 7758
9 Ga0123353_10105135 3300010167 Bacteria 4550
10 Ga0123354_10015187 3300010882 Unclassified 12014
11 Ga0466706_170395 3300042599 Bacteria 2699
12 Ga0466700_343884 3300042600 Bacteria 6021
13 Ga0466707_252919 3300042601 Unclassified 5444
14 Ga0466713_063713 3300042602 Bacteria 3816
15 Ga0466720_088052 3300042607 Bacteria 4839
16 Ga0466720_184959 3300042607 Bacteria 21554
17 Ga0466722_001837 3300042609 Bacteria 6141
18 Ga0466698_015827 3300042610 Bacteria 4433
19 Ga0466698_066337 3300042610 Bacteria 2606
20 AustNasuHG_c1001844 3300000089 Bacteria 7668
21 JGI24698J34947_10002806 3300002449 Bacteria 9444
22 JGI24698J34947_10018946 3300002449 Bacteria 3717
23 JGI24695J34938_10000121 3300002450 Bacteria 70058
24 JGI24695J34938_10000211 3300002450 Bacteria 55384
25 JGI24695J34938_10000325 3300002450 Bacteria 46894
26 JGI24695J34938_10000460 3300002450 Bacteria 39601
27 JGI24695J34938_10001156 3300002450 Bacteria 23495
28 JGI24695J34938_10003594 3300002450 Bacteria 10668
29 JGI24695J34938_10004090 3300002450 Bacteria 9735
30 JGI24695J34938_10011627 3300002450 Bacteria 4730
31 JGI24702J35022_10005741 3300002462 Bacteria 7233
32 Ga0068305_10193639 3300005083 Bacteria 3473
33 Ga0072940_1089826 3300005200 Bacteria 2733
34 Ga0072941_1040556 3300005201 Bacteria 3249
35 Ga0466732_213320 3300042656 Bacteria 1746
36 Ga0562375_0293 3300056856 Bacteria 126554
37 Ga0466734_096300 3300042623 Bacteria 3272
38 Ga0466735_205913 3300042624 Bacteria 18220
39 Ga0466704_025103 3300042643 Bacteria 41445
40 Ga0466704_465015 3300042643 Bacteria 1621
41 Ga0466704_469009 3300042643 Bacteria 5087
42 Ga0466709_041428 3300042648 Bacteria 6365
43 Ga0466727_257505 3300042655 Bacteria 4972
44 Ga0456237_0003056 3300041968 Bacteria 2722
45 Ga0466690_029043 3300042590 Bacteria 8258
46 Ga0466690_032392 3300042590 Bacteria 8147
47 Ga0466693_152830 3300042592 Bacteria 52782
48 Ga0466691_210056 3300042593 Bacteria 10365
49 Ga0466694_065842 3300042594 Bacteria 35703
50 Ga0466694_252954 3300042594 Bacteria 25516
51 Ga0466694_306193 3300042594 Bacteria 3066
52 Ga0466696_475434 3300042596 Bacteria 3952
53 Ga0466699_043667 3300042597 Bacteria 16827
54 Ga0466712_032047 3300042614 Bacteria 4752
55 Ga0466712_096881 3300042614 Bacteria 2544
56 Ga0466712_265690 3300042614 Bacteria 51797
57 Ga0466711_067357 3300042615 Bacteria 4463
58 Ga0466711_080006 3300042615 Bacteria 15829
59 Ga0466711_156617 3300042615 Bacteria 24481
60 Ga0466715_292515 3300042616 Archaea 1945
61 Ga0466715_453353 3300042616 Bacteria 8318
62 Ga0466718_003131 3300042617 Bacteria 3908
63 Ga0466718_086476 3300042617 Bacteria 18485
64 Ga0466723_065582 3300042618 Bacteria 48796
65 Ga0466723_146637 3300042618 Bacteria 10250
66 Ga0466726_094968 3300042619 Bacteria 2575
67 Ga0466729_117106 3300042621 Bacteria 12671
68 Ga0123355_10000852 3300009826 Bacteria 42059
69 Ga0123355_10121023 3300009826 Bacteria 4060
70 Ga0123355_10241154 3300009826 Bacteria 2561
71 Ga0123356_10004829 3300010049 Bacteria 13869
72 Ga0123353_10074072 3300010167 Bacteria 5473
73 Ga0466706_192668 3300042599 Bacteria 87404
74 Ga0466700_407240 3300042600 Bacteria 2338
75 Ga0466707_015678 3300042601 Bacteria 6263
76 Ga0466707_090672 3300042601 Bacteria 2862
77 Ga0466713_075483 3300042602 Bacteria 53395
78 Ga0466714_018470 3300042603 Bacteria 4740
79 Ga0466716_068655 3300042605 Bacteria 4117
80 Ga0466719_351366 3300042606 Bacteria 5914
81 IMNBL1DRAFT_c0000008 3300000062 Bacteria 244959
82 AustNasuHG_c1007426 3300000089 Bacteria 3904
83 JGI24698J34947_10010249 3300002449 Bacteria 5139
84 JGI24698J34947_10010718 3300002449 Bacteria 5031
85 JGI24695J34938_10014994 3300002450 Bacteria 3993
86 Ga0466732_299772 3300042656 Bacteria 4025
87 Ga0466733_211004 3300042659 Bacteria 2640
88 Ga0562376_0004 3300056857 Bacteria 3026470
89 Ga0466705_225523 3300042612 Bacteria 6845
90 Ga0466705_317846 3300042612 Bacteria 7664
91 Ga0466731_077465 3300042622 Bacteria 2904
92 Ga0466704_220990 3300042643 Bacteria 9010
93 Ga0466704_305186 3300042643 Bacteria 4764
94 Ga0466704_545564 3300042643 Bacteria 5928
95 Ga0466709_077345 3300042648 Bacteria 7393
96 Ga0466708_008520 3300042652 Bacteria 2400
97 Ga0466708_091453 3300042652 Bacteria 19162
98 Ga0466727_056296 3300042655 Bacteria 1985
99 Ga0264413_105318 3300024493 Bacteria 5964
100 Ga0415639_020642 3300038395 Unclassified 6494
101 Ga0466692_073374 3300042591 Unclassified 4387
102 Ga0466692_156008 3300042591 Bacteria 4936
103 Ga0466693_073622 3300042592 Bacteria 3298
104 Ga0466691_075973 3300042593 Bacteria 8414
105 Ga0466694_023621 3300042594 Bacteria 46663
106 Ga0466696_411535 3300042596 Bacteria 5557
107 Ga0466705_484798 3300042612 Bacteria 5640
108 Ga0466712_025216 3300042614 Bacteria 25841
109 Ga0466712_128264 3300042614 Bacteria 6723
110 Ga0466712_190460 3300042614 Bacteria 6302
111 Ga0466715_078165 3300042616 Bacteria 38467
112 Ga0466715_133115 3300042616 Bacteria 18546
113 Ga0466715_150282 3300042616 Bacteria 2806
114 Ga0466715_638735 3300042616 Bacteria 3466
115 Ga0466718_076131 3300042617 Bacteria 3267
116 Ga0466723_008274 3300042618 Bacteria 6115
117 Ga0466723_066143 3300042618 Bacteria 8929
118 Ga0466723_372623 3300042618 Bacteria 20648
119 Ga0466726_189137 3300042619 Bacteria 3495
120 Ga0466726_301501 3300042619 Bacteria 2740
121 Ga0123355_10000073 3300009826 Bacteria 107394
122 Ga0123355_10001136 3300009826 Bacteria 36890
123 Ga0123355_10002975 3300009826 Bacteria 24077
124 Ga0123355_10029976 3300009826 Bacteria 8815
125 Ga0123355_10118564 3300009826 Bacteria 4112
126 Ga0123356_10048667 3300010049 Bacteria 3945
127 Ga0123356_10115008 3300010049 Bacteria 2606
128 Ga0123353_10005488 3300010167 Bacteria 16664
129 Ga0123353_10023642 3300010167 Bacteria 9311
130 Ga0123353_10134725 3300010167 Bacteria 3962
131 Ga0123353_10267032 3300010167 Bacteria 2639
132 Ga0466706_056223 3300042599 Bacteria 4790
133 Ga0466707_064229 3300042601 Bacteria 2785
134 Ga0466707_112517 3300042601 Bacteria 26341
135 Ga0466713_055259 3300042602 Bacteria 39117
136 Ga0466714_056233 3300042603 Bacteria 2178
137 Ga0466714_079893 3300042603 Bacteria 5220
138 Ga0466719_115653 3300042606 Bacteria 5369
139 Ga0466719_538973 3300042606 Bacteria 100873
140 Ga0466720_073917 3300042607 Bacteria 2933
141 Ga0466720_081091 3300042607 Bacteria 1675
142 Ga0466720_097164 3300042607 Bacteria 17030
143 Ga0466720_114164 3300042607 Bacteria 13602
144 Ga0466720_183633 3300042607 Bacteria 7620
145 Ga0466722_015349 3300042609 Bacteria 7072
146 IMNBL1DRAFT_c0005991 3300000062 Bacteria 6784
147 AustNasuHG_c1005612 3300000089 Bacteria 4489
148 AustNasuHG_c1008785 3300000089 Bacteria 3573
149 JGI24698J34947_10010818 3300002449 Bacteria 5009
150 JGI24695J34938_10001964 3300002450 Bacteria 16479
151 JGI24695J34938_10009750 3300002450 Bacteria 5316
152 Ga0072940_1038110 3300005200 Bacteria 5360
153 Ga0072941_1001609 3300005201 Bacteria 14944
154 Ga0466732_013049 3300042656 Bacteria 24009
155 Ga0466733_035916 3300042659 Bacteria 3732
156 Ga0466733_090286 3300042659 Bacteria 40500
157 Ga0466733_136733 3300042659 Bacteria 5494
158 Ga0466733_140727 3300042659 Bacteria 2985
159 Ga0466733_173078 3300042659 Bacteria 2140
160 Ga0466705_250161 3300042612 Bacteria 2711
161 Ga0466705_287047 3300042612 Bacteria 6855
162 Ga0466702_104486 3300042635 Bacteria 3616
163 Ga0466703_088653 3300042636 Bacteria 5111
164 Ga0466703_106666 3300042636 Bacteria 12360
165 Ga0466703_125283 3300042636 Bacteria 47897
166 Ga0466703_226363 3300042636 Bacteria 40320
167 Ga0466704_188928 3300042643 Bacteria 4523
168 Ga0466709_182914 3300042648 Bacteria 5507
169 Ga0466708_072239 3300042652 Bacteria 14259
170 Ga0466708_187464 3300042652 Bacteria 7672
171 Ga0160453_100093 3300012814 Bacteria 94595
172 Ga0160441_100075 3300012825 Unclassified 121634
173 Ga0415639_020641 3300038395 Bacteria 6636
174 Ga0415639_026498 3300038395 Bacteria 5577
175 Ga0415639_042141 3300038395 Bacteria 3538
176 Ga0466690_380487 3300042590 Bacteria 8713
177 Ga0466693_272908 3300042592 Bacteria 38745
178 Ga0466691_007284 3300042593 Bacteria 7504
179 Ga0466691_102092 3300042593 Bacteria 2664
180 Ga0466694_253097 3300042594 Bacteria 3587
181 Ga0466695_178889 3300042595 Bacteria 70582
182 Ga0466696_150402 3300042596 Bacteria 5379
183 Ga0466699_078194 3300042597 Bacteria 4027
184 Ga0466699_342051 3300042597 Bacteria 19986
185 Ga0466712_123773 3300042614 Bacteria 5462
186 Ga0466711_065727 3300042615 Bacteria 3083
187 Ga0466711_361603 3300042615 Bacteria 16589
188 Ga0466715_009918 3300042616 Bacteria 14581
189 Ga0466715_521776 3300042616 Bacteria 5883
190 Ga0466723_005924 3300042618 Bacteria 37995
191 Ga0466723_132421 3300042618 Bacteria 16358
192 Ga0466726_044505 3300042619 Bacteria 34716
193 Ga0466728_007274 3300042620 Bacteria 6822
194 Ga0123357_10081083 3300009784 Bacteria 4266
195 Ga0123357_10086490 3300009784 Bacteria 4101
196 Ga0123355_10000587 3300009826 Bacteria 49043
197 Ga0123355_10004472 3300009826 Bacteria 20339
198 Ga0123355_10173072 3300009826 Bacteria 3221
199 Ga0123355_10263120 3300009826 Bacteria 2409
200 Ga0123355_10317879 3300009826 Bacteria 2102
201 Ga0123355_10366842 3300009826 Bacteria 1891
202 Ga0123356_10000067 3300010049 Bacteria 109410
203 Ga0123356_10003453 3300010049 Bacteria 16537
204 Ga0123356_10181123 3300010049 Bacteria 2129
205 Ga0123356_10218846 3300010049 Bacteria 1959
206 Ga0123356_10222611 3300010049 Bacteria 1944
207 Ga0466700_087192 3300042600 Bacteria 4437
208 Ga0466707_094927 3300042601 Bacteria 2665
209 Ga0466707_208628 3300042601 Bacteria 2249
210 Ga0466707_290265 3300042601 Bacteria 80468
211 Ga0466707_315563 3300042601 Bacteria 13358
212 Ga0466713_044716 3300042602 Bacteria 26822
213 Ga0466713_126279 3300042602 Bacteria 9411
214 Ga0466714_085735 3300042603 Bacteria 10186
215 Ga0466714_128007 3300042603 Bacteria 3948
216 Ga0466716_051670 3300042605 Bacteria 13729
217 Ga0466716_057864 3300042605 Bacteria 6218
218 Ga0466719_148376 3300042606 Bacteria 23878
219 Ga0466720_007684 3300042607 Bacteria 4976
220 Ga0466722_059609 3300042609 Bacteria 16020
221 AustNasuHG_c1001317 3300000089 Bacteria 8908
222 JGI24698J34947_10000548 3300002449 Bacteria 17805
223 JGI24698J34947_10026405 3300002449 Bacteria 3086
224 JGI24698J34947_10038180 3300002449 Bacteria 2491
225 JGI24698J34947_10040867 3300002449 Bacteria 2392
226 JGI24695J34938_10000225 3300002450 Bacteria 53584
227 JGI24695J34938_10008220 3300002450 Bacteria 5978
228 JGI24695J34938_10008881 3300002450 Bacteria 5676
229 JGI24695J34938_10013928 3300002450 Bacteria 4198
230 JGI24702J35022_10042449 3300002462 Bacteria 2422
231 JGI24703J35330_11748608 3300002501 Bacteria 21865
232 Ga0074263_113263 3300005485 Bacteria 2762
233 Ga0074263_113666 3300005485 Bacteria 6994
234 Ga0466732_059336 3300042656 Bacteria 2044
235 Ga0466733_001659 3300042659 Bacteria 1837
236 Ga0562379_0276 3300056790 Bacteria 132006
237 Ga0562377_1739 3300056842 Bacteria 20305
238 Ga0466705_107434 3300042612 Bacteria 2142
239 Ga0466705_148373 3300042612 Bacteria 16387
240 Ga0466705_183546 3300042612 Bacteria 8418
241 Ga0466729_244109 3300042621 Bacteria 1391
242 Ga0466731_322037 3300042622 Bacteria 4647
243 Ga0466703_162812 3300042636 Bacteria 83208
244 Ga0466703_212383 3300042636 Bacteria 15812
245 Ga0466703_221553 3300042636 Bacteria 5164
246 Ga0466703_299289 3300042636 Bacteria 42101
247 Ga0466704_342827 3300042643 Bacteria 4742
248 Ga0466704_582895 3300042643 Bacteria 4592
249 Ga0466708_010140 3300042652 Bacteria 2051
250 Ga0466727_240218 3300042655 Bacteria 6202
251 Ga0264413_129910 3300024493 Bacteria 2375
252 Ga0415639_000490 3300038395 Bacteria 58918
253 Ga0415639_006123 3300038395 Bacteria 6170
254 Ga0415639_012683 3300038395 Bacteria 21384
255 Ga0415639_059174 3300038395 Bacteria 6486
256 Ga0466690_291275 3300042590 Bacteria 5861
257 Ga0466694_051268 3300042594 Bacteria 15292
258 Ga0466696_188922 3300042596 Bacteria 3189
259 Ga0466696_306970 3300042596 Bacteria 15566
260 Ga0466699_074511 3300042597 Bacteria 2175
261 Ga0466712_019537 3300042614 Bacteria 2917
262 Ga0466712_049264 3300042614 Bacteria 9851
263 Ga0466712_134355 3300042614 Bacteria 2416
264 Ga0466712_307073 3300042614 Bacteria 2378
265 Ga0466711_113580 3300042615 Bacteria 17630
266 Ga0466715_480186 3300042616 Bacteria 32538
267 Ga0466718_016929 3300042617 Bacteria 3237
268 Ga0466718_086242 3300042617 Bacteria 67871
269 Ga0466718_155251 3300042617 Bacteria 12332
270 Ga0466723_037688 3300042618 Bacteria 12902
271 Ga0466723_238009 3300042618 Bacteria 1568
272 Ga0466726_171642 3300042619 Bacteria 8433
273 Ga0466726_189493 3300042619 Bacteria 8444
274 Ga0466728_434559 3300042620 Bacteria 3877
275 Ga0123355_10020463 3300009826 Bacteria 10568
276 Ga0123355_10205443 3300009826 Bacteria 2867
277 Ga0123355_10296613 3300009826 Bacteria 2210
278 Ga0123356_10000614 3300010049 Bacteria 39394
279 Ga0123356_10061388 3300010049 Bacteria 3510
280 Ga0123356_10062984 3300010049 Bacteria 3464
281 Ga0123356_10091080 3300010049 Bacteria 2905
282 Ga0123356_10153570 3300010049 Bacteria 2289
283 Ga0123356_10182200 3300010049 Bacteria 2123
284 Ga0123353_10000595 3300010167 Bacteria 44226
285 Ga0123353_10007420 3300010167 Bacteria 14804
286 Ga0123353_10098578 3300010167 Bacteria 4710
287 Ga0123353_10230589 3300010167 Bacteria 2887
288 Ga0466713_067922 3300042602 Bacteria 8597
289 Ga0466714_091644 3300042603 Bacteria 1707
290 Ga0466716_112355 3300042605 Unclassified 13741
291 Ga0466716_138985 3300042605 Bacteria 3151
292 Ga0466719_095451 3300042606 Bacteria 7895
293 Ga0466719_453612 3300042606 Bacteria 1919
294 Ga0466720_017976 3300042607 Bacteria 2374
295 Ga0466720_058778 3300042607 Bacteria 2780
296 Ga0466720_110725 3300042607 Archaea 24728
297 Ga0466720_144134 3300042607 Bacteria 2948
298 Ga0466720_219584 3300042607 Bacteria 92443
299 Ga0466721_117007 3300042608 Bacteria 1908
300 Ga0466722_016049 3300042609 Bacteria 16374
301 Ga0466722_058180 3300042609 Bacteria 8646
302 Ga0466722_090546 3300042609 Bacteria 4833
303 Ga0466722_091485 3300042609 Bacteria 2086
304 Ga0466722_240038 3300042609 Bacteria 12390
305 Ga0466722_257568 3300042609 Bacteria 2660
306 JGI24698J34947_10002601 3300002449 Bacteria 9741
307 JGI24698J34947_10004029 3300002449 Bacteria 7986
308 JGI24695J34938_10006435 3300002450 Bacteria 7053
309 JGI24699J35502_11117426 3300002509 Bacteria 3030
310 Ga0074263_106743 3300005485 Bacteria 3698
311 Ga0123357_10000071 3300009784 Bacteria 83758
312 Ga0562379_0009 3300056790 Bacteria 1927879
313 Ga0562379_1702 3300056790 Unclassified 22916
314 Ga0466697_231478 3300042611 Bacteria 2730
315 Ga0466705_021219 3300042612 Bacteria 4557
316 Ga0466705_250025 3300042612 Bacteria 7509
317 Ga0466705_302811 3300042612 Unclassified 3702
318 Ga0466729_239447 3300042621 Bacteria 2690
319 Ga0466731_130596 3300042622 Bacteria 4177
320 Ga0466735_066970 3300042624 Bacteria 9715
321 Ga0466702_062256 3300042635 Bacteria 47552
322 Ga0466703_021933 3300042636 Bacteria 10429
323 Ga0466703_077169 3300042636 Bacteria 5053
324 Ga0466704_003340 3300042643 Bacteria 20173
325 Ga0466704_131522 3300042643 Bacteria 18444
326 Ga0466704_410095 3300042643 Bacteria 2184
327 Ga0466709_372642 3300042648 Bacteria 101634
328 Ga0466724_19958 3300042649 Bacteria 7924
329 Ga0466727_113662 3300042655 Bacteria 4228
330 Ga0466727_229947 3300042655 Bacteria 39176
331 Ga0264413_105401 3300024493 Bacteria 3023
332 Ga0415639_109719 3300038395 Unclassified 5548
333 Ga0466692_106084 3300042591 Bacteria 14312
334 Ga0466692_188024 3300042591 Bacteria 12713
335 Ga0466693_121857 3300042592 Bacteria 33009
336 Ga0466691_006485 3300042593 Bacteria 33041
337 Ga0466691_129198 3300042593 Bacteria 3745
338 Ga0466694_263262 3300042594 Bacteria 4591
339 Ga0466696_021329 3300042596 Bacteria 5395
340 Ga0466696_099620 3300042596 Bacteria 11001
341 Ga0466696_354784 3300042596 Bacteria 20829
342 Ga0466696_492957 3300042596 Bacteria 9966
343 Ga0466705_506647 3300042612 Bacteria 2362
344 Ga0466712_039374 3300042614 Bacteria 9624
345 Ga0466712_214936 3300042614 Bacteria 9864
346 Ga0466712_253345 3300042614 Bacteria 13207
347 Ga0466711_277458 3300042615 Bacteria 5830
348 Ga0466715_030910 3300042616 Bacteria 32636
349 Ga0466715_083021 3300042616 Bacteria 1883
350 Ga0466715_277432 3300042616 Bacteria 20810
351 Ga0466718_009764 3300042617 Bacteria 6525
352 Ga0466723_175430 3300042618 Bacteria 8042
353 Ga0466726_003842 3300042619 Bacteria 3213
354 Ga0466726_317162 3300042619 Bacteria 11182
355 Ga0123357_10024981 3300009784 Bacteria 8055
356 Ga0123355_10000383 3300009826 Bacteria 57113
357 Ga0123355_10075787 3300009826 Bacteria 5382
358 Ga0123355_10292569 3300009826 Bacteria 2233
359 Ga0123356_10000560 3300010049 Bacteria 41371
360 Ga0123356_10004430 3300010049 Bacteria 14515
361 Ga0123356_10069621 3300010049 Bacteria 3300
362 Ga0123353_10146348 3300010167 Bacteria 3777
363 Ga0466707_373299 3300042601 Bacteria 3719
364 Ga0466713_038902 3300042602 Bacteria 1900
365 Ga0466713_045525 3300042602 Bacteria 77003
366 Ga0466713_082142 3300042602 Bacteria 10465
367 Ga0466714_024759 3300042603 Bacteria 6403
368 Ga0466717_138256 3300042604 Bacteria 2396
369 Ga0466716_046031 3300042605 Bacteria 11488
370 Ga0466716_546122 3300042605 Bacteria 3815
371 Ga0466719_081224 3300042606 Bacteria 28336
372 Ga0466719_436219 3300042606 Bacteria 2731
373 Ga0466720_059142 3300042607 Bacteria 2030
374 Ga0466720_099902 3300042607 Bacteria 33350
375 Ga0466720_105286 3300042607 Bacteria 21064
376 Ga0466720_209398 3300042607 Bacteria 4388
377 Ga0466721_160537 3300042608 Bacteria 71411
378 Ga0466722_065970 3300042609 Bacteria 19867
379 Ga0466722_141310 3300042609 Bacteria 15329
380 IMNBL1DRAFT_c0004116 3300000062 Bacteria 8879
381 AustNasuHG_c1003651 3300000089 Bacteria 5549
382 JGI24698J34947_10017701 3300002449 Bacteria 3858
383 JGI24695J34938_10000069 3300002450 Bacteria 86031
384 JGI24695J34938_10000125 3300002450 Bacteria 68505
385 JGI24695J34938_10000239 3300002450 Bacteria 52549
386 JGI24695J34938_10000702 3300002450 Bacteria 31504
387 JGI24695J34938_10002464 3300002450 Bacteria 14131
388 JGI24702J35022_10000693 3300002462 Bacteria 20593
389 JGI24699J35502_11133859 3300002509 Bacteria 17307
390 Ga0072941_1013035 3300005201 Bacteria 11283
391 Ga0072941_1048287 3300005201 Bacteria 6047
392 Ga0123357_10000202 3300009784 Bacteria 56062
393 Ga0466732_114342 3300042656 Bacteria 13888
394 Ga0466732_306070 3300042656 Archaea 2030
395 Ga0562378_0008 3300056814 Bacteria 1370151
396 Ga0466705_087310 3300042612 Bacteria 4391
397 Ga0466702_044190 3300042635 Bacteria 10237
398 Ga0466702_133226 3300042635 Bacteria 3370
399 Ga0466703_352814 3300042636 Bacteria 2113
400 Ga0466703_400664 3300042636 Bacteria 2638
401 Ga0466704_325185 3300042643 Bacteria 25821
402 Ga0466704_555918 3300042643 Bacteria 3733
403 Ga0466709_105394 3300042648 Bacteria 14214
404 Ga0466708_065302 3300042652 Bacteria 6177
405 Ga0466708_441889 3300042652 Bacteria 15969
406 Ga0466725_290270 3300042654 Bacteria 3790
407 Ga0466727_211963 3300042655 Bacteria 5664
408 Ga0264413_116402 3300024493 Bacteria 2313
409 Ga0264413_135178 3300024493 Bacteria 1890
410 Ga0415639_003828 3300038395 Bacteria 19671
411 Ga0456237_0000100 3300041968 Bacteria 12328
412 Ga0466690_065552 3300042590 Bacteria 48080
413 Ga0466692_015761 3300042591 Bacteria 1736
414 Ga0466691_124878 3300042593 Bacteria 9196
415 Ga0466695_162582 3300042595 Bacteria 11843
416 Ga0466699_338001 3300042597 Bacteria 21108
417 Ga0466715_089417 3300042616 Bacteria 27330
418 Ga0466715_353205 3300042616 Bacteria 46875
419 Ga0466715_403636 3300042616 Bacteria 8491
420 Ga0466718_042306 3300042617 Bacteria 2933
421 Ga0466718_081679 3300042617 Bacteria 5637
422 Ga0466718_106602 3300042617 Bacteria 21056
423 Ga0466723_202592 3300042618 Bacteria 5897
424 Ga0466728_068265 3300042620 Bacteria 6186
425 Ga0123355_10147967 3300009826 Bacteria 3575
426 Ga0123356_10005850 3300010049 Bacteria 12485
427 Ga0123356_10011679 3300010049 Bacteria 8554
428 Ga0123356_10016355 3300010049 Bacteria 7079
429 Ga0123356_10060246 3300010049 Bacteria 3542
430 Ga0123353_10000032 3300010167 Bacteria 153370
431 Ga0123353_10000148 3300010167 Bacteria 87348
432 Ga0123353_10039331 3300010167 Bacteria 7443
433 Ga0123353_10149816 3300010167 Bacteria 3726
434 Ga0123353_10510287 3300010167 Bacteria 1748
435 Ga0466700_117029 3300042600 Bacteria 6171
436 Ga0466700_434070 3300042600 Bacteria 3249
437 Ga0466707_138885 3300042601 Bacteria 24067
438 Ga0466707_375444 3300042601 Bacteria 2182
439 Ga0466713_044566 3300042602 Bacteria 41501
440 Ga0466719_044277 3300042606 Bacteria 5063
441 Ga0466719_277831 3300042606 Bacteria 7066
442 Ga0466720_008542 3300042607 Bacteria 40016
443 Ga0466720_040973 3300042607 Bacteria 6938
444 Ga0466720_122833 3300042607 Bacteria 4666
445 Ga0466722_021999 3300042609 Bacteria 5443
446 Ga0466722_173995 3300042609 Bacteria 4298
447 2227205810 2225789004 Bacteria 7686
448 2227330769 2225789004 Bacteria 29043
449 AustNasuHG_c1000014 3300000089 Bacteria 40235
450 JGI24698J34947_10005412 3300002449 Bacteria 7003
451 JGI24698J34947_10014807 3300002449 Bacteria 4247
452 JGI24695J34938_10000666 3300002450 Bacteria 32494
453 JGI24695J34938_10023503 3300002450 Bacteria 2971
454 JGI24695J34938_10023611 3300002450 Bacteria 2963
455 JGI24702J35022_10000440 3300002462 Bacteria 25100
456 JGI24702J35022_10008751 3300002462 Bacteria 5713
457 Ga0072940_1216275 3300005200 Bacteria 2873
458 Ga0074263_104696 3300005485 Bacteria 3147
459 Ga0466733_016630 3300042659 Bacteria 26058
460 Ga0466733_016751 3300042659 Bacteria 4664
461 Ga0466733_077558 3300042659 Bacteria 2963
462 Ga0466697_217442 3300042611 Bacteria 9359
463 Ga0466705_030797 3300042612 Bacteria 6185
464 Ga0466705_318869 3300042612 Bacteria 7251
465 Ga0466705_364717 3300042612 Bacteria 5175
466 Ga0466731_046733 3300042622 Bacteria 2844
467 Ga0466735_117999 3300042624 Bacteria 1947
468 Ga0466704_049139 3300042643 Bacteria 37521
469 Ga0466704_177776 3300042643 Bacteria 23150
470 Ga0466709_102347 3300042648 Bacteria 4415
471 Ga0466708_087667 3300042652 Bacteria 3275
472 Ga0466708_344973 3300042652 Bacteria 11995
473 Ga0255809_1010431 3300022820 Bacteria 2424
474 Ga0415639_090117 3300038395 Bacteria 4229
475 Ga0466692_108149 3300042591 Bacteria 13887
476 Ga0466693_398500 3300042592 Unclassified 1652
477 Ga0466694_290351 3300042594 Bacteria 1743
478 Ga0466699_441266 3300042597 Bacteria 28353
479 Ga0466712_150260 3300042614 Bacteria 6404
480 Ga0466712_310089 3300042614 Bacteria 8755
481 Ga0466712_310176 3300042614 Bacteria 26726
482 Ga0466711_261403 3300042615 Bacteria 8840
483 Ga0466715_117340 3300042616 Bacteria 1918
484 Ga0466718_031420 3300042617 Bacteria 6043
485 Ga0466718_039794 3300042617 Bacteria 2477
486 Ga0466718_040089 3300042617 Bacteria 3060
487 Ga0466718_113314 3300042617 Bacteria 1733
488 Ga0123355_10151841 3300009826 Bacteria 3516
489 Ga0123356_10007094 3300010049 Bacteria 11229
490 Ga0123356_10013174 3300010049 Bacteria 7997
491 Ga0123356_10098963 3300010049 Bacteria 2794
492 Ga0123356_10169599 3300010049 Bacteria 2191
493 Ga0123353_10007070 3300010167 Bacteria 15103
494 Ga0123353_10010874 3300010167 Bacteria 12749
495 Ga0123353_10017449 3300010167 Bacteria 10555
496 Ga0123353_10044970 3300010167 Bacteria 7004
497 Ga0123353_10086497 3300010167 Bacteria 5048
498 Ga0466706_128056 3300042599 Bacteria 4576
499 Ga0466707_250402 3300042601 Bacteria 2422
500 Ga0466714_038172 3300042603 Bacteria 21587
501 Ga0466719_228809 3300042606 Bacteria 5093
502 Ga0466720_012731 3300042607 Bacteria 38091
503 Ga0466720_014621 3300042607 Bacteria 102324
504 Ga0466720_124792 3300042607 Bacteria 21794
505 Ga0466720_208981 3300042607 Bacteria 3036
506 Ga0466722_006672 3300042609 Bacteria 2657
507 Ga0466722_143765 3300042609 Bacteria 14954
508 Ga0466722_148857 3300042609 Bacteria 4235
509 Ga0466722_173402 3300042609 Bacteria 5374
510 Ga0466722_173777 3300042609 Bacteria 6798
511 Ga0466722_236612 3300042609 Bacteria 1974
512 Ga0466698_466169 3300042610 Bacteria 3284
513 AustNasuHG_c1000471 3300000089 Bacteria 14140
514 AustNasuHG_c1001375 3300000089 Bacteria 8701
515 AustNasuHG_c1001432 3300000089 Bacteria 8535
516 AustNasuHG_c1009804 3300000089 Bacteria 3352
517 JGI24698J34947_10007262 3300002449 Bacteria 6088
518 JGI24695J34938_10000368 3300002450 Bacteria 44588
519 JGI24695J34938_10043825 3300002450 Bacteria 1993
520 JGI24700J35501_10925386 3300002508 Bacteria 5797
521 Ga0068305_10004865 3300005083 Bacteria 25301
522 Ga0072941_1006638 3300005201 Bacteria 20983
523 Ga0072941_1024375 3300005201 Bacteria 12506
524 Ga0074278_105389 3300005721 Bacteria 2546
525 Ga0466727_349017 3300042655 Bacteria 2156
526 Ga0562374_0007 3300057007 Bacteria 2074405
527 Ga0466705_133616 3300042612 Bacteria 12320
528 Ga0466705_185603 3300042612 Bacteria 7938
529 Ga0466705_196810 3300042612 Bacteria 3340
530 Ga0466702_130778 3300042635 Bacteria 2904
531 Ga0466703_387789 3300042636 Bacteria 6650
532 Ga0466704_346911 3300042643 Bacteria 6699
533 Ga0466704_395172 3300042643 Bacteria 6672
534 Ga0466709_338224 3300042648 Bacteria 4651
535 Ga0466708_067650 3300042652 Bacteria 28053
536 Ga0466727_059390 3300042655 Bacteria 17715
537 Ga0456237_0000530 3300041968 Bacteria 5813
538 Ga0466690_054274 3300042590 Bacteria 6380
539 Ga0466690_125539 3300042590 Bacteria 14644
540 Ga0466690_154804 3300042590 Bacteria 6200
541 Ga0466692_078488 3300042591 Bacteria 8446
542 Ga0466691_073014 3300042593 Bacteria 2737
543 Ga0466694_079165 3300042594 Bacteria 40053
544 Ga0466694_305315 3300042594 Bacteria 2573
545 Ga0466696_170278 3300042596 Bacteria 3038
546 Ga0466696_315735 3300042596 Bacteria 1970
547 Ga0466712_074489 3300042614 Bacteria 14619
548 Ga0466712_083267 3300042614 Bacteria 26241
549 Ga0466712_166301 3300042614 Unclassified 5183
550 Ga0466711_048613 3300042615 Bacteria 3123
551 Ga0466711_136256 3300042615 Bacteria 3535
552 Ga0466711_469346 3300042615 Bacteria 4696
553 Ga0466715_030288 3300042616 Bacteria 6117
554 Ga0466715_070312 3300042616 Bacteria 5389
555 Ga0466715_087551 3300042616 Bacteria 2501
556 Ga0466718_033027 3300042617 Bacteria 9463
557 Ga0466718_079004 3300042617 Bacteria 20039
558 Ga0466726_053719 3300042619 Bacteria 8234
559 Ga0466726_292913 3300042619 Bacteria 4707
560 Ga0466729_114890 3300042621 Bacteria 7273

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain 320 517 0.9
PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain 61 285 0.82

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.