Protein Family IF07905
Metagenome
Isolate
166
Members
74
Samples
147
Scaffolds
215.83
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_049821|Ga0466718_049821_14886_15584
- Length
- 232 aa
- Sequence
- MTDVKNIIAARAAKELKDGDVVNLGIGIPTLVVNFLPPGIDIILQSENGIMGMGPTPSSGEVNMDIVNAGGLPVTVKKGAAFFDSATSFGIIRGGHVDATIMGALEVDEKGNISNWIVPGKTIPGMGGAMDLAAAAKKVIVAMTHTRKDAPKILKNCTLPFTALGVVDMIITEMGVMEITPDGIVLTELHPDFTKEQIQEATGVNLIISPDLKPMAIGSNVFDPDSRFPAPH
Sample Types
Isolate
11.4%
Metagenome
88.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.7%
Kalotermitidae
20.3%
Coreidae
11.6%
Unclassified
10.1%
Rhinotermitidae
5.8%
Termopsidae
5.8%
Culicidae
2.9%
Scarabaeidae
1.4%
Drosophilidae
1.4%
Hydrophilidae
1.4%
Passalidae
1.4%
Taxonomy
Archaea
0
Bacteria
159
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 8 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 9 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 10 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 15 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 16 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 17 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 24 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 25 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 35 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 36 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 37 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 38 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 39 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 40 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 43 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 44 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 47 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 48 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 51 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 54 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 55 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 56 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 57 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 58 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 59 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 60 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 61 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 62 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 63 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 64 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 65 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 66 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 67 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 68 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 69 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 70 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 71 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 72 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 73 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 74 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_004229 | 3300042612 | Bacteria | 1694 |
| 2 | Ga0466705_103215 | 3300042612 | Bacteria | 7213 |
| 3 | Ga0466732_273868 | 3300042656 | Bacteria | 2011 |
| 4 | Ga0456237_0002427 | 3300041968 | Unclassified | 3016 |
| 5 | Ga0466692_036479 | 3300042591 | Bacteria | 8250 |
| 6 | Ga0466701_003696 | 3300042598 | Bacteria | 2027 |
| 7 | Ga0466712_028252 | 3300042614 | Bacteria | 3496 |
| 8 | Ga0466718_024243 | 3300042617 | Bacteria | 2870 |
| 9 | Ga0466718_032587 | 3300042617 | Bacteria | 3251 |
| 10 | Ga0466720_051023 | 3300042607 | Bacteria | 19706 |
| 11 | Ga0466704_045497 | 3300042643 | Bacteria | 37022 |
| 12 | Ga0123357_10439135 | 3300009784 | Bacteria | 1144 |
| 13 | Ga0123355_10606544 | 3300009826 | Bacteria | 1296 |
| 14 | Ga0123355_10865275 | 3300009826 | Bacteria | 991 |
| 15 | AustNasuHG_c1010385 | 3300000089 | Bacteria | 3245 |
| 16 | Ga0074263_105238 | 3300005485 | Bacteria | 3596 |
| 17 | Ga0466732_099962 | 3300042656 | Bacteria | 27941 |
| 18 | Ga0466692_161586 | 3300042591 | Bacteria | 2779 |
| 19 | Ga0466712_262439 | 3300042614 | Bacteria | 14129 |
| 20 | Ga0466711_092268 | 3300042615 | Bacteria | 3577 |
| 21 | Ga0466715_074488 | 3300042616 | Bacteria | 7840 |
| 22 | Ga0466718_167658 | 3300042617 | Bacteria | 9976 |
| 23 | Ga0466728_030000 | 3300042620 | Bacteria | 13175 |
| 24 | Ga0466707_050021 | 3300042601 | Bacteria | 3639 |
| 25 | Ga0466719_192266 | 3300042606 | Bacteria | 6231 |
| 26 | Ga0466720_107517 | 3300042607 | Bacteria | 53647 |
| 27 | Ga0466722_239653 | 3300042609 | Bacteria | 1872 |
| 28 | Ga0123353_10854566 | 3300010167 | Unclassified | 1247 |
| 29 | Ga0123354_10104970 | 3300010882 | Bacteria | 3784 |
| 30 | IMNBL1DRAFT_c0013825 | 3300000062 | Bacteria | 3595 |
| 31 | AustNasuHG_c1014353 | 3300000089 | Bacteria | 2697 |
| 32 | JGI24698J34947_10012332 | 3300002449 | Bacteria | 4684 |
| 33 | JGI24698J34947_10026622 | 3300002449 | Bacteria | 3072 |
| 34 | JGI24695J34938_10000418 | 3300002450 | Bacteria | 41411 |
| 35 | Ga0466732_049629 | 3300042656 | Bacteria | 22386 |
| 36 | Ga0160441_103155 | 3300012825 | Bacteria | 2936 |
| 37 | Ga0160431_105879 | 3300012828 | Bacteria | 1956 |
| 38 | Ga0466690_045686 | 3300042590 | Bacteria | 1203 |
| 39 | Ga0466692_089700 | 3300042591 | Bacteria | 1081 |
| 40 | Ga0466691_153164 | 3300042593 | Bacteria | 6452 |
| 41 | Ga0466712_092920 | 3300042614 | Bacteria | 1254 |
| 42 | Ga0466715_309330 | 3300042616 | Bacteria | 5953 |
| 43 | Ga0466718_034918 | 3300042617 | Bacteria | 3345 |
| 44 | Ga0466718_046944 | 3300042617 | Bacteria | 23335 |
| 45 | Ga0466726_322769 | 3300042619 | Bacteria | 1148 |
| 46 | Ga0466729_135047 | 3300042621 | Bacteria | 31219 |
| 47 | Ga0466713_069033 | 3300042602 | Bacteria | 130314 |
| 48 | Ga0466722_064750 | 3300042609 | Bacteria | 3038 |
| 49 | Ga0466722_102291 | 3300042609 | Bacteria | 2612 |
| 50 | Ga0466703_351562 | 3300042636 | Unclassified | 1451 |
| 51 | Ga0466704_399241 | 3300042643 | Bacteria | 15889 |
| 52 | Ga0466727_055243 | 3300042655 | Bacteria | 2088 |
| 53 | Ga0123356_10557277 | 3300010049 | Bacteria | 1308 |
| 54 | JGI24702J35022_10005416 | 3300002462 | Bacteria | 7468 |
| 55 | Ga0466732_185101 | 3300042656 | Bacteria | 3681 |
| 56 | Ga0466690_176250 | 3300042590 | Bacteria | 1510 |
| 57 | Ga0466691_100981 | 3300042593 | Bacteria | 7051 |
| 58 | Ga0466715_035814 | 3300042616 | Bacteria | 3688 |
| 59 | Ga0466718_130445 | 3300042617 | Bacteria | 1040 |
| 60 | Ga0466723_319690 | 3300042618 | Bacteria | 8383 |
| 61 | Ga0466728_307464 | 3300042620 | Bacteria | 2239 |
| 62 | Ga0466714_093319 | 3300042603 | Bacteria | 1881 |
| 63 | Ga0466719_337699 | 3300042606 | Bacteria | 3956 |
| 64 | Ga0466720_203829 | 3300042607 | Bacteria | 3874 |
| 65 | Ga0466735_007504 | 3300042624 | Bacteria | 7602 |
| 66 | Ga0466735_153971 | 3300042624 | Bacteria | 1415 |
| 67 | Ga0466727_144429 | 3300042655 | Bacteria | 1150 |
| 68 | Ga0123356_10069306 | 3300010049 | Bacteria | 3307 |
| 69 | Ga0123353_10196713 | 3300010167 | Bacteria | 3177 |
| 70 | Ga0123353_11304730 | 3300010167 | Bacteria | 942 |
| 71 | JGI24698J34947_10009448 | 3300002449 | Bacteria | 5352 |
| 72 | JGI24698J34947_10056965 | 3300002449 | Bacteria | 1941 |
| 73 | Ga0072941_1048289 | 3300005201 | Bacteria | 12919 |
| 74 | Ga0160446_100459 | 3300012835 | Bacteria | 18457 |
| 75 | Ga0466657_147126 | 3300042582 | Bacteria | 8091 |
| 76 | Ga0466692_035522 | 3300042591 | Unclassified | 5956 |
| 77 | Ga0466692_154859 | 3300042591 | Bacteria | 5317 |
| 78 | Ga0466694_383607 | 3300042594 | Bacteria | 2461 |
| 79 | Ga0466696_452408 | 3300042596 | Bacteria | 2046 |
| 80 | Ga0466715_001017 | 3300042616 | Bacteria | 12101 |
| 81 | Ga0466718_001494 | 3300042617 | Bacteria | 1919 |
| 82 | Ga0466718_046836 | 3300042617 | Bacteria | 2989 |
| 83 | Ga0466726_046977 | 3300042619 | Bacteria | 4709 |
| 84 | Ga0466726_048733 | 3300042619 | Bacteria | 1192 |
| 85 | Ga0466714_002266 | 3300042603 | Bacteria | 1278 |
| 86 | Ga0466714_030104 | 3300042603 | Bacteria | 1564 |
| 87 | Ga0466716_219621 | 3300042605 | Bacteria | 13242 |
| 88 | Ga0466722_196751 | 3300042609 | Bacteria | 5186 |
| 89 | Ga0466709_285329 | 3300042648 | Bacteria | 6327 |
| 90 | Ga0466708_109111 | 3300042652 | Bacteria | 12786 |
| 91 | Ga0466708_394662 | 3300042652 | Bacteria | 1081 |
| 92 | Ga0123353_10145779 | 3300010167 | Bacteria | 3785 |
| 93 | Ga0123354_10333260 | 3300010882 | Unclassified | 1380 |
| 94 | JGI24697J35500_11272933 | 3300002507 | Bacteria | 5255 |
| 95 | Ga0072941_1005857 | 3300005201 | Bacteria | 2987 |
| 96 | Ga0072941_1029279 | 3300005201 | Bacteria | 9606 |
| 97 | Ga0466705_074632 | 3300042612 | Bacteria | 22401 |
| 98 | Ga0466732_414836 | 3300042656 | Bacteria | 4785 |
| 99 | Ga0466733_196545 | 3300042659 | Bacteria | 2227 |
| 100 | Ga0466656_004021 | 3300042550 | Bacteria | 1704 |
| 101 | Ga0466692_008841 | 3300042591 | Bacteria | 5314 |
| 102 | Ga0466692_050627 | 3300042591 | Bacteria | 1815 |
| 103 | Ga0466692_096131 | 3300042591 | Bacteria | 2371 |
| 104 | Ga0466692_104119 | 3300042591 | Bacteria | 1897 |
| 105 | Ga0466712_059886 | 3300042614 | Bacteria | 32530 |
| 106 | Ga0466718_049821 | 3300042617 | Bacteria | 16731 |
| 107 | Ga0466719_460965 | 3300042606 | Bacteria | 1129 |
| 108 | Ga0466720_018561 | 3300042607 | Bacteria | 1415 |
| 109 | Ga0466734_090241 | 3300042623 | Bacteria | 1350 |
| 110 | Ga0466704_283318 | 3300042643 | Bacteria | 1983 |
| 111 | Ga0466709_406372 | 3300042648 | Bacteria | 7785 |
| 112 | Ga0123353_10333161 | 3300010167 | Unclassified | 2296 |
| 113 | Ga0123353_11541278 | 3300010167 | Bacteria | 843 |
| 114 | JGI24698J34947_10050968 | 3300002449 | Bacteria | 2085 |
| 115 | JGI24705J35276_12223495 | 3300002504 | Bacteria | 2515 |
| 116 | Ga0072941_1017217 | 3300005201 | Bacteria | 7344 |
| 117 | Ga0466697_150845 | 3300042611 | Bacteria | 1186 |
| 118 | Ga0466733_095429 | 3300042659 | Bacteria | 17535 |
| 119 | Ga0466726_362632 | 3300042619 | Bacteria | 6547 |
| 120 | Ga0123357_10085307 | 3300009784 | Bacteria | 4135 |
| 121 | Ga0123353_10907941 | 3300010167 | Bacteria | 1198 |
| 122 | Ga0123353_11338406 | 3300010167 | Bacteria | 926 |
| 123 | AustNasuHG_c1000978 | 3300000089 | Bacteria | 10300 |
| 124 | JGI24695J34938_10056471 | 3300002450 | Bacteria | 1692 |
| 125 | Ga0072941_1047601 | 3300005201 | Bacteria | 6334 |
| 126 | Ga0074263_115099 | 3300005485 | Bacteria | 2119 |
| 127 | Ga0466705_106416 | 3300042612 | Unclassified | 1073 |
| 128 | Ga0160460_101953 | 3300012845 | Bacteria | 5578 |
| 129 | Ga0466690_012460 | 3300042590 | Bacteria | 15225 |
| 130 | Ga0466692_037332 | 3300042591 | Bacteria | 3469 |
| 131 | Ga0466692_181390 | 3300042591 | Bacteria | 19604 |
| 132 | Ga0466712_319953 | 3300042614 | Bacteria | 9383 |
| 133 | Ga0466718_047621 | 3300042617 | Bacteria | 7333 |
| 134 | Ga0466718_073000 | 3300042617 | Bacteria | 36315 |
| 135 | Ga0466718_102600 | 3300042617 | Bacteria | 17725 |
| 136 | Ga0466718_130668 | 3300042617 | Bacteria | 3232 |
| 137 | Ga0466718_161589 | 3300042617 | Bacteria | 41024 |
| 138 | Ga0466723_159293 | 3300042618 | Bacteria | 2631 |
| 139 | Ga0466723_329899 | 3300042618 | Bacteria | 3066 |
| 140 | Ga0466700_085580 | 3300042600 | Bacteria | 1083 |
| 141 | Ga0466700_168422 | 3300042600 | Bacteria | 1534 |
| 142 | Ga0466707_294340 | 3300042601 | Bacteria | 1208 |
| 143 | Ga0466720_087563 | 3300042607 | Bacteria | 11752 |
| 144 | Ga0466704_190371 | 3300042643 | Bacteria | 2127 |
| 145 | JGI24700J35501_10918580 | 3300002508 | Bacteria | 4290 |
| 146 | Ga0068302_10191429 | 3300005071 | Bacteria | 2623 |
| 147 | Ga0072941_1027767 | 3300005201 | Bacteria | 1686 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01144 | CoA_trans | Coenzyme A transferase | 8 | 200 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01144 | GO:0008410 | CoA-transferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.