Protein Family IF07728
Metagenome
Isolate
431
Members
299
Samples
207
Scaffolds
112.74
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_250169|Ga0466715_250169_660_1001
- Length
- 113 aa
- Sequence
- MKKVEAIIRTEKLEDVKDALVKNNLAKGLTVSQVLGHGTQKGFPEFVRGQEILTTLLAKVKLEIITTEDRAEKVAELIQKTARTGEVGDGKIFIYPIEQVIRIRTGETDESAI
Sample Types
Isolate
52.0%
Metagenome
48.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.9%
Termitidae
7.7%
Drosophilidae
7.4%
Anthocoridae
7.4%
Kalotermitidae
4.9%
Muscidae
4.6%
Culicidae
4.2%
Tenebrionidae
3.5%
Curculionidae
3.5%
Calliphoridae
3.2%
Formicidae
2.1%
Tephritidae
1.8%
Rhinotermitidae
1.4%
Elmidae
1.4%
Aphididae
1.4%
Cerambycidae
1.4%
Apidae
1.4%
Palinuridae
1.1%
Termopsidae
1.1%
Talitridae
1.1%
Pentatomidae
0.7%
Sarcophagidae
0.7%
Crambidae
0.7%
Blattidae
0.7%
Daphniidae
0.4%
Passalidae
0.4%
Thripidae
0.4%
Anthomyiidae
0.4%
Artemiidae
0.4%
Alydidae
0.4%
Pteromalidae
0.4%
Majidae
0.4%
Scarabaeidae
0.4%
Ceratophyllidae
0.4%
Nephropidae
0.4%
Rhopalidae
0.4%
Penaeidae
0.4%
Glossinidae
0.4%
Carabidae
0.4%
Coreidae
0.4%
Armadillidiidae
0.4%
Taxonomy
Archaea
0
Bacteria
388
Eukaryota
0
Viruses
0
Unclassified
43
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 2 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 3 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 4 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 5 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 6 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 7 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 8 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 9 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 10 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 11 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 12 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 13 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 14 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 15 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 16 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 19 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 20 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 21 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 22 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 23 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 24 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 25 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 26 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 27 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 39 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 40 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 41 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 42 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 43 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 44 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 45 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 46 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 47 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 50 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 51 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 52 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 53 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 54 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 55 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 56 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 57 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 58 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 59 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 60 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 61 | 3300007507 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut | Metagenome | Drosophilidae |
| 62 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 63 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 64 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 65 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 66 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 67 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 68 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 69 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 70 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 71 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 72 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 73 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 74 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 75 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 76 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 77 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 78 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 79 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 80 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 81 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 82 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 83 | 2958255616 | Serratia marcescens TM | Isolate | |
| 84 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 85 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 86 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 87 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 88 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 89 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 90 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 91 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 92 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 93 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 94 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 95 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 96 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 97 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 98 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 99 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 100 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 101 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 102 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 103 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 104 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 105 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 106 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 107 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 108 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 109 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 110 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 111 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 112 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 113 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 114 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 115 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 116 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 117 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 118 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 119 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 120 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 121 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 122 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 123 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 124 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 125 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 126 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 127 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 128 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 129 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 130 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 131 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 132 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 133 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 134 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 135 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 136 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 137 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 138 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 139 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 140 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 141 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 142 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 143 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 144 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 145 | 2528768011 | Serratia symbiotica SCt-VLC | Isolate | Aphididae |
| 146 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 147 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 148 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 149 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 150 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 151 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 152 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 153 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 154 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 155 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 156 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 157 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 158 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 159 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 160 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 161 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 162 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 163 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 164 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 165 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 166 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 167 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 168 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 169 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 170 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 171 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 172 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 173 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 174 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 175 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 176 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 177 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 178 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 179 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 180 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 181 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 182 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 183 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 184 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 185 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 186 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 187 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 188 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 189 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 190 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 191 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 192 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 193 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 194 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 195 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 196 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 197 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 198 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 199 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 200 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 201 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 202 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 203 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 204 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 205 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 206 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 207 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 208 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 209 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 210 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 211 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 212 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 213 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 214 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 215 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 216 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 217 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 218 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 219 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 220 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 221 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 222 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 223 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 224 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 225 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 226 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 227 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 228 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 229 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 230 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 231 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 232 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 233 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 234 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 235 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 236 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 237 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 238 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 239 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 240 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 241 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 242 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 243 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 244 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 245 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 246 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 247 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 248 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 249 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 250 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 251 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 252 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 253 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 254 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 255 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 256 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 257 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 258 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 259 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 260 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 261 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 262 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 263 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 264 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 265 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 266 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 267 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 268 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 269 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 270 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 271 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 272 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 273 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 274 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 275 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 276 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 277 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 278 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 279 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 280 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 281 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 282 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 283 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 284 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 285 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 286 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 287 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 288 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 289 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 290 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 291 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 292 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 293 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 294 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 295 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 296 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 297 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 298 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 299 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_085767 | 3300042601 | Bacteria | 92057 |
| 2 | Ga0466719_517123 | 3300042606 | Unclassified | 2057 |
| 3 | Ga0466722_005904 | 3300042609 | Bacteria | 6210 |
| 4 | Ga0466722_152018 | 3300042609 | Bacteria | 2053 |
| 5 | Ga0562379_0681 | 3300056790 | Unclassified | 57878 |
| 6 | Ga0123355_11540254 | 3300009826 | Unclassified | 645 |
| 7 | Ga0160431_100018 | 3300012828 | Bacteria | 173296 |
| 8 | Ga0466657_100834 | 3300042582 | Bacteria | 2810 |
| 9 | Ga0466690_141895 | 3300042590 | Unclassified | 1806 |
| 10 | Ga0466692_115808 | 3300042591 | Bacteria | 16044 |
| 11 | Ga0466691_027086 | 3300042593 | Bacteria | 3858 |
| 12 | IMNBGM34_c000015 | 3300000036 | Bacteria | 47738 |
| 13 | HBC_ctgsDRAFT_1004467 | 3300000333 | Bacteria | 3244 |
| 14 | HBC_ctgsDRAFT_1011070 | 3300000333 | Bacteria | 2154 |
| 15 | Ga0072941_1321794 | 3300005201 | Bacteria | 1163 |
| 16 | Ga0105008_1097230 | 3300007507 | Unclassified | 2143 |
| 17 | Ga0466711_138047 | 3300042615 | Bacteria | 1266 |
| 18 | Ga0466715_128452 | 3300042616 | Bacteria | 25205 |
| 19 | Ga0466715_338967 | 3300042616 | Bacteria | 15425 |
| 20 | Ga0466726_178713 | 3300042619 | Bacteria | 5875 |
| 21 | Ga0466729_090361 | 3300042621 | Bacteria | 1125 |
| 22 | Ga0466731_173710 | 3300042622 | Bacteria | 5283 |
| 23 | Ga0466704_480324 | 3300042643 | Bacteria | 57822 |
| 24 | Ga0466709_390481 | 3300042648 | Bacteria | 2429 |
| 25 | Ga0466707_107166 | 3300042601 | Bacteria | 11000 |
| 26 | Ga0466707_302721 | 3300042601 | Bacteria | 3772 |
| 27 | Ga0466713_122277 | 3300042602 | Bacteria | 18801 |
| 28 | Ga0466719_292771 | 3300042606 | Unclassified | 1676 |
| 29 | Ga0562379_4621 | 3300056790 | Bacteria | 6587 |
| 30 | Ga0562379_4728 | 3300056790 | Unclassified | 6272 |
| 31 | Ga0562375_0229 | 3300056856 | Unclassified | 154884 |
| 32 | Ga0562374_0091 | 3300057007 | Bacteria | 255104 |
| 33 | Ga0123356_10001231 | 3300010049 | Bacteria | 28442 |
| 34 | Ga0123356_10004577 | 3300010049 | Unclassified | 14256 |
| 35 | Ga0123356_13233935 | 3300010049 | Bacteria | 567 |
| 36 | Ga0123354_10025493 | 3300010882 | Bacteria | 9323 |
| 37 | Ga0160442_109005 | 3300012806 | Bacteria | 922 |
| 38 | Ga0160470_101166 | 3300012813 | Bacteria | 6909 |
| 39 | Ga0265387_1000829 | 3300024582 | Unclassified | 4702 |
| 40 | IMNBGM34_c000054 | 3300000036 | Bacteria | 32127 |
| 41 | IMNBGM34_c044271 | 3300000036 | Unclassified | 579 |
| 42 | Ga0063521_1000022 | 3300003973 | Bacteria | 133586 |
| 43 | Ga0063521_1000211 | 3300003973 | Bacteria | 41476 |
| 44 | Ga0102737_1000393 | 3300007142 | Bacteria | 14743 |
| 45 | Ga0103264_1000103 | 3300007188 | Bacteria | 95820 |
| 46 | Ga0103264_1012825 | 3300007188 | Bacteria | 4111 |
| 47 | Ga0103264_1024331 | 3300007188 | Unclassified | 4955 |
| 48 | Ga0105005_1017544 | 3300007505 | Bacteria | 19255 |
| 49 | Ga0105008_1093452 | 3300007507 | Unclassified | 2027 |
| 50 | Ga0466715_162141 | 3300042616 | Bacteria | 1240 |
| 51 | Ga0466715_357109 | 3300042616 | Bacteria | 17968 |
| 52 | Ga0466728_330894 | 3300042620 | Bacteria | 2188 |
| 53 | Ga0466734_060661 | 3300042623 | Bacteria | 37945 |
| 54 | Ga0466734_107392 | 3300042623 | Bacteria | 3204 |
| 55 | Ga0466704_070839 | 3300042643 | Bacteria | 1990 |
| 56 | Ga0466704_234613 | 3300042643 | Bacteria | 1322 |
| 57 | Ga0466724_00951 | 3300042649 | Unclassified | 13465 |
| 58 | Ga0466708_043725 | 3300042652 | Bacteria | 17261 |
| 59 | Ga0466707_024269 | 3300042601 | Bacteria | 18210 |
| 60 | Ga0466716_400646 | 3300042605 | Bacteria | 1157 |
| 61 | Ga0466722_121307 | 3300042609 | Bacteria | 1328 |
| 62 | Ga0530661_000762 | 3300056564 | Unclassified | 20761 |
| 63 | Ga0123354_10000052 | 3300010882 | Bacteria | 88097 |
| 64 | Ga0466657_016905 | 3300042582 | Bacteria | 1259 |
| 65 | Ga0466657_091603 | 3300042582 | Bacteria | 1144 |
| 66 | Ga0466657_185230 | 3300042582 | Bacteria | 1119 |
| 67 | Ga0466657_289336 | 3300042582 | Bacteria | 8238 |
| 68 | Ga0466690_274886 | 3300042590 | Bacteria | 3366 |
| 69 | Ga0466696_051662 | 3300042596 | Bacteria | 9998 |
| 70 | IMNBGM34_c000261 | 3300000036 | Bacteria | 15218 |
| 71 | IMNBGM34_c002273 | 3300000036 | Bacteria | 2860 |
| 72 | JGI24696J40584_12939875 | 3300002834 | Unclassified | 1663 |
| 73 | CVPL005W_1000080 | 3300002934 | Bacteria | 37325 |
| 74 | Ga0466715_102112 | 3300042616 | Bacteria | 1317 |
| 75 | Ga0466723_045341 | 3300042618 | Bacteria | 29933 |
| 76 | Ga0466723_125499 | 3300042618 | Bacteria | 1263 |
| 77 | Ga0466723_195165 | 3300042618 | Bacteria | 2265 |
| 78 | Ga0466705_369077 | 3300042612 | Unclassified | 44107 |
| 79 | Ga0466735_102806 | 3300042624 | Bacteria | 2642 |
| 80 | Ga0466709_163755 | 3300042648 | Bacteria | 13399 |
| 81 | Ga0466724_61555 | 3300042649 | Unclassified | 12942 |
| 82 | Ga0466707_208432 | 3300042601 | Unclassified | 3532 |
| 83 | Ga0466713_064983 | 3300042602 | Bacteria | 2074 |
| 84 | Ga0466713_152207 | 3300042602 | Bacteria | 1094 |
| 85 | Ga0466719_112674 | 3300042606 | Bacteria | 2225 |
| 86 | Ga0123356_10140157 | 3300010049 | Bacteria | 2384 |
| 87 | Ga0160471_108545 | 3300012812 | Unclassified | 1189 |
| 88 | Ga0160455_100051 | 3300012837 | Bacteria | 249063 |
| 89 | Ga0466690_069916 | 3300042590 | Bacteria | 3135 |
| 90 | IMNBGM34_c013878 | 3300000036 | Bacteria | 1007 |
| 91 | Ga0466710_095352 | 3300042613 | Bacteria | 3541 |
| 92 | Ga0466726_337541 | 3300042619 | Bacteria | 1009 |
| 93 | Ga0466703_297825 | 3300042636 | Bacteria | 8070 |
| 94 | Ga0466704_274392 | 3300042643 | Unclassified | 8106 |
| 95 | Ga0466704_476609 | 3300042643 | Bacteria | 3896 |
| 96 | Ga0466708_129182 | 3300042652 | Bacteria | 7620 |
| 97 | Ga0466725_365387 | 3300042654 | Bacteria | 33756 |
| 98 | Ga0466707_112432 | 3300042601 | Bacteria | 3033 |
| 99 | Ga0466707_235278 | 3300042601 | Unclassified | 8046 |
| 100 | Ga0466707_264074 | 3300042601 | Bacteria | 1601 |
| 101 | Ga0466719_147814 | 3300042606 | Bacteria | 6222 |
| 102 | Ga0466722_008217 | 3300042609 | Unclassified | 1498 |
| 103 | Ga0466733_196082 | 3300042659 | Bacteria | 37545 |
| 104 | Ga0123356_10385320 | 3300010049 | Unclassified | 1535 |
| 105 | Ga0160472_100232 | 3300012839 | Bacteria | 66467 |
| 106 | Ga0160448_100022 | 3300012854 | Bacteria | 202960 |
| 107 | Ga0466657_297072 | 3300042582 | Bacteria | 1812 |
| 108 | Ga0466692_106049 | 3300042591 | Bacteria | 2195 |
| 109 | Ga0466692_179382 | 3300042591 | Bacteria | 27457 |
| 110 | Ga0466691_221612 | 3300042593 | Bacteria | 1688 |
| 111 | JGI24695J34938_10094917 | 3300002450 | Bacteria | 1222 |
| 112 | JGI24702J35022_10001526 | 3300002462 | Bacteria | 14369 |
| 113 | Ga0063521_1000049 | 3300003973 | Bacteria | 105543 |
| 114 | Ga0104042_1038561 | 3300007130 | Unclassified | 1826 |
| 115 | Ga0466705_394169 | 3300042612 | Bacteria | 1468 |
| 116 | Ga0466723_068598 | 3300042618 | Bacteria | 5548 |
| 117 | Ga0466705_150060 | 3300042612 | Bacteria | 4042 |
| 118 | Ga0466705_365037 | 3300042612 | Unclassified | 2046 |
| 119 | Ga0466729_293111 | 3300042621 | Bacteria | 2326 |
| 120 | Ga0466703_411926 | 3300042636 | Unclassified | 5881 |
| 121 | Ga0466704_537859 | 3300042643 | Unclassified | 8170 |
| 122 | Ga0466709_017161 | 3300042648 | Bacteria | 1268 |
| 123 | Ga0466708_102826 | 3300042652 | Bacteria | 39124 |
| 124 | Ga0466725_107158 | 3300042654 | Bacteria | 6510 |
| 125 | Ga0466725_397386 | 3300042654 | Unclassified | 2784 |
| 126 | Ga0466701_059753 | 3300042598 | Bacteria | 6405 |
| 127 | Ga0466707_050802 | 3300042601 | Bacteria | 7866 |
| 128 | Ga0466707_211324 | 3300042601 | Bacteria | 4512 |
| 129 | Ga0466713_070399 | 3300042602 | Bacteria | 88794 |
| 130 | Ga0466719_063811 | 3300042606 | Bacteria | 12327 |
| 131 | Ga0466719_134778 | 3300042606 | Bacteria | 1115 |
| 132 | Ga0466719_342730 | 3300042606 | Bacteria | 2403 |
| 133 | Ga0466719_354029 | 3300042606 | Bacteria | 1209 |
| 134 | Ga0466722_069801 | 3300042609 | Bacteria | 2809 |
| 135 | Ga0466722_243125 | 3300042609 | Bacteria | 10434 |
| 136 | Ga0562375_0065 | 3300056856 | Bacteria | 412749 |
| 137 | Ga0123353_10000212 | 3300010167 | Bacteria | 73953 |
| 138 | Ga0160436_1010039 | 3300012861 | Unclassified | 2071 |
| 139 | Ga0466692_049838 | 3300042591 | Bacteria | 185020 |
| 140 | FGTW_contig31706 | 2065487013 | Unclassified | 3523 |
| 141 | Meta3P_1000347 | 3300002464 | Unclassified | 24826 |
| 142 | Ga0074188_1000220 | 3300005318 | Bacteria | 34540 |
| 143 | Ga0102736_1001341 | 3300007052 | Bacteria | 4336 |
| 144 | Ga0103264_1000032 | 3300007188 | Bacteria | 148835 |
| 145 | Ga0123357_10000011 | 3300009784 | Bacteria | 173575 |
| 146 | Ga0466710_020131 | 3300042613 | Bacteria | 1255 |
| 147 | Ga0466726_282636 | 3300042619 | Bacteria | 16987 |
| 148 | Ga0466728_140024 | 3300042620 | Bacteria | 4688 |
| 149 | Ga0466705_173682 | 3300042612 | Bacteria | 11802 |
| 150 | Ga0466730_031437 | 3300042625 | Unclassified | 37757 |
| 151 | Ga0466702_239735 | 3300042635 | Bacteria | 18941 |
| 152 | Ga0466703_403352 | 3300042636 | Bacteria | 1193 |
| 153 | Ga0466704_161690 | 3300042643 | Bacteria | 5738 |
| 154 | Ga0466713_065172 | 3300042602 | Bacteria | 2046 |
| 155 | Ga0466717_183607 | 3300042604 | Bacteria | 9559 |
| 156 | Ga0466716_059639 | 3300042605 | Bacteria | 48128 |
| 157 | Ga0466719_226197 | 3300042606 | Bacteria | 4738 |
| 158 | Ga0466719_270473 | 3300042606 | Bacteria | 2001 |
| 159 | Ga0466722_093067 | 3300042609 | Bacteria | 25071 |
| 160 | Ga0123357_10369183 | 3300009784 | Bacteria | 1347 |
| 161 | Ga0123357_10418134 | 3300009784 | Unclassified | 1199 |
| 162 | Ga0123355_10511117 | 3300009826 | Bacteria | 1476 |
| 163 | Ga0123356_10064362 | 3300010049 | Unclassified | 3428 |
| 164 | Ga0123354_10224554 | 3300010882 | Bacteria | 1984 |
| 165 | Ga0160446_100480 | 3300012835 | Unclassified | 17315 |
| 166 | Ga0466657_021650 | 3300042582 | Bacteria | 6609 |
| 167 | Ga0466696_174978 | 3300042596 | Bacteria | 2976 |
| 168 | DPOL_contig14637 | 2035918003 | Bacteria | 83088 |
| 169 | CVPL005W_1000257 | 3300002934 | Bacteria | 23073 |
| 170 | CVPL005L_10021790 | 3300002938 | Bacteria | 3072 |
| 171 | Ga0074311_1190243 | 3300005317 | Bacteria | 539 |
| 172 | Ga0074311_1192375 | 3300005317 | Bacteria | 529 |
| 173 | Ga0105005_1024619 | 3300007505 | Unclassified | 2857 |
| 174 | Ga0466715_250169 | 3300042616 | Bacteria | 28538 |
| 175 | Ga0466718_117217 | 3300042617 | Bacteria | 1136 |
| 176 | Ga0466726_293984 | 3300042619 | Bacteria | 1030 |
| 177 | Ga0466728_338844 | 3300042620 | Unclassified | 3727 |
| 178 | Ga0466728_419804 | 3300042620 | Bacteria | 3913 |
| 179 | Ga0466729_298879 | 3300042621 | Bacteria | 94207 |
| 180 | Ga0466734_012056 | 3300042623 | Bacteria | 25616 |
| 181 | Ga0466703_153671 | 3300042636 | Bacteria | 1995 |
| 182 | Ga0466703_234815 | 3300042636 | Bacteria | 52704 |
| 183 | Ga0466724_56022 | 3300042649 | Unclassified | 14651 |
| 184 | Ga0466708_212214 | 3300042652 | Bacteria | 5950 |
| 185 | Ga0466701_046584 | 3300042598 | Bacteria | 6257 |
| 186 | Ga0466701_050348 | 3300042598 | Bacteria | 1046 |
| 187 | Ga0466707_131320 | 3300042601 | Unclassified | 1329 |
| 188 | Ga0466719_300281 | 3300042606 | Bacteria | 2983 |
| 189 | Ga0466721_027227 | 3300042608 | Bacteria | 5825 |
| 190 | Ga0123356_10252620 | 3300010049 | Unclassified | 1842 |
| 191 | Ga0316159_10604 | 3300030930 | Bacteria | 5343 |
| 192 | Ga0466693_194500 | 3300042592 | Bacteria | 1740 |
| 193 | Ga0466691_064617 | 3300042593 | Bacteria | 3055 |
| 194 | Ga0466696_196374 | 3300042596 | Bacteria | 23288 |
| 195 | Ga0072941_1430482 | 3300005201 | Bacteria | 829 |
| 196 | Ga0104147_1016501 | 3300007224 | Unclassified | 15474 |
| 197 | Ga0466710_007969 | 3300042613 | Bacteria | 6040 |
| 198 | Ga0466711_110862 | 3300042615 | Bacteria | 20810 |
| 199 | Ga0466726_425263 | 3300042619 | Bacteria | 15829 |
| 200 | Ga0466728_388476 | 3300042620 | Bacteria | 2108 |
| 201 | Ga0466729_071924 | 3300042621 | Unclassified | 1461 |
| 202 | Ga0466705_110668 | 3300042612 | Bacteria | 1142 |
| 203 | Ga0466734_002784 | 3300042623 | Bacteria | 5039 |
| 204 | Ga0466734_100222 | 3300042623 | Bacteria | 1397 |
| 205 | Ga0466709_417048 | 3300042648 | Bacteria | 14680 |
| 206 | Ga0466725_149167 | 3300042654 | Bacteria | 121753 |
| 207 | Ga0466727_151827 | 3300042655 | Bacteria | 15595 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00543 | P-II | Nitrogen regulatory protein P-II | 1 | 107 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.