Protein Family IF07728

Metagenome Isolate
431 Members
299 Samples
207 Scaffolds
112.74 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_250169|Ga0466715_250169_660_1001
Length
113 aa
Sequence
MKKVEAIIRTEKLEDVKDALVKNNLAKGLTVSQVLGHGTQKGFPEFVRGQEILTTLLAKVKLEIITTEDRAEKVAELIQKTARTGEVGDGKIFIYPIEQVIRIRTGETDESAI

πŸ“Š Sample Types

Isolate 52.0%
Metagenome 48.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 30.9%
Termitidae 7.7%
Drosophilidae 7.4%
Anthocoridae 7.4%
Kalotermitidae 4.9%
Muscidae 4.6%
Culicidae 4.2%
Tenebrionidae 3.5%
Curculionidae 3.5%
Calliphoridae 3.2%
Formicidae 2.1%
Tephritidae 1.8%
Rhinotermitidae 1.4%
Elmidae 1.4%
Aphididae 1.4%
Cerambycidae 1.4%
Apidae 1.4%
Palinuridae 1.1%
Termopsidae 1.1%
Talitridae 1.1%
Pentatomidae 0.7%
Sarcophagidae 0.7%
Crambidae 0.7%
Blattidae 0.7%
Daphniidae 0.4%
Passalidae 0.4%
Thripidae 0.4%
Anthomyiidae 0.4%
Artemiidae 0.4%
Alydidae 0.4%
Pteromalidae 0.4%
Majidae 0.4%
Scarabaeidae 0.4%
Ceratophyllidae 0.4%
Nephropidae 0.4%
Rhopalidae 0.4%
Penaeidae 0.4%
Glossinidae 0.4%
Carabidae 0.4%
Coreidae 0.4%
Armadillidiidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 388
Eukaryota 0
Viruses 0
Unclassified 43

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
2 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
3 2574179716 Serratia sp. DD3 Isolate Daphniidae
4 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
5 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
6 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
7 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
8 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
9 2718217944 Serratia marcescens AS1 Isolate Culicidae
10 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
11 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
12 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
13 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
14 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
15 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
16 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
20 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
21 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
22 8100176769 Kosakonia sp. S57 Isolate Curculionidae
23 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
24 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
25 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
26 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
27 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
32 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
33 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
34 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
35 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
36 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
37 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
38 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
39 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
40 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
41 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
42 2836714267 Shimwellia blattae NCTC10965 Isolate
43 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
44 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
45 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
46 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
47 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
48 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
49 8021546568 Klebsiella sp. Kps Isolate Tephritidae
50 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
51 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
52 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
53 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
54 8071322446 Escherichia coli PN122 Isolate Calliphoridae
55 8100171289 Kosakonia sp. S42 Isolate Curculionidae
56 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
57 8103002986 Erwinia sp. S38 Isolate Curculionidae
58 8103008710 Erwinia sp. S43 Isolate Curculionidae
59 2971189173 Yersinia pestis A-1249 Isolate Unclassified
60 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
61 3300007507 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 4 gut Metagenome Drosophilidae
62 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
63 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
64 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
65 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
66 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
67 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
68 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
69 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
70 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
71 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
72 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
73 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
74 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
75 2850895757 Vibrio campbellii 170502 Isolate Unclassified
76 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
77 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
78 2872471378 Vibrio owensii V180403 Isolate Unclassified
79 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
80 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
81 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
82 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
83 2958255616 Serratia marcescens TM Isolate
84 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
85 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
86 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
87 651324086 Plautia crossota stali symbiont Isolate Unclassified
88 8001059720 Tenebrionicola larvae YMB-R22 Isolate Tenebrionidae
89 8022087107 Vibrio sp. OULL4 Isolate Unclassified
90 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
91 8062647588 Nissabacter archeti JGM97 Isolate Drosophilidae
92 8071333649 Escherichia coli PN108 Isolate Calliphoridae
93 8071338694 Escherichia coli PN87 Isolate Calliphoridae
94 8102982778 Erwinia sp. S63 Isolate Curculionidae
95 3001459110 Tatumella sp. JGM118 Isolate Drosophilidae
96 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
97 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
98 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
99 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
100 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
101 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
102 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
103 2508501043 Desulfovibrio termitidis HI1 Isolate Rhinotermitidae
104 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
105 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
106 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
107 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
108 2554235022 Vibrio parahaemolyticus v110 Isolate
109 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
110 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
111 2648501209 Winslowiella iniecta B149 Isolate Aphididae
112 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
113 2703719239 Serratia marcescens ano1 Isolate Unclassified
114 2778261153 Escherichia coli MOD1-EC286 Isolate Unclassified
115 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
116 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
117 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
118 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
119 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
120 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
121 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
122 2885050628 Erwinia sp. OLMTSP26 Isolate Anthocoridae
123 2885061987 Erwinia sp. OLFS4 Isolate Anthocoridae
124 2885065815 Erwinia sp. OAMSP11 Isolate Anthocoridae
125 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
126 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
127 2912570088 Vibrio parahaemolyticus CHN25 Isolate
128 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
129 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
130 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
131 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
132 651285005 Serratia symbiotica Tuscon Isolate Aphididae
133 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
134 8004541719 Serratia marcescens KZ19 Isolate Apidae
135 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
136 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
137 8051551332 Vibrio vulnificus Vv003 Isolate
138 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
139 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
140 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
141 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
142 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
143 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
144 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
145 2528768011 Serratia symbiotica SCt-VLC Isolate Aphididae
146 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
147 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
148 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
149 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
150 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
151 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
152 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
153 2791355473 Vibrio barjaei 3062 Isolate Unclassified
154 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
155 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
156 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
157 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
158 2898975184 Erwinia dacicola IL Isolate Tephritidae
159 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
160 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
161 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
162 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
163 8018312681 Enterobacter sp. OLF Isolate Tephritidae
164 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
165 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
166 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
167 8051534459 Vibrio vulnificus Vv004 Isolate
168 8099192374 Erwinia typographi IC4 Isolate Curculionidae
169 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae
170 2978161719 Serratia marcescens KZ2 Isolate Apidae
171 3000861951 Budvicia diplopodorum D9 Isolate
172 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
173 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
174 3006242587 Vibrio sp. RE86 Isolate Unclassified
175 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
176 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
177 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
178 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
179 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
180 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
181 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
182 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
183 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
184 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
185 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
186 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
187 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
188 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
189 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
190 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
191 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
192 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
193 2837516909 Rahnella bruchi DSM 27398 Isolate Unclassified
194 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
195 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
196 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
197 2885043073 Erwinia sp. OLSSP12 Isolate Anthocoridae
198 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
199 2937735258 Serratia marcescens KZ11 Isolate Apidae
200 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
201 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
202 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
203 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
204 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
205 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
206 8100181737 Kosakonia sp. S58 Isolate Curculionidae
207 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
208 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
209 2978102237 Serratia fonticola AeS1 Isolate Culicidae
210 3007994558 Escherichia alba B35 Isolate Tenebrionidae
211 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
212 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
213 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
214 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
215 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
216 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
217 2511231129 Vibrio sp. EJY3 Isolate Unclassified
218 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
219 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
220 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
221 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
222 2645727860 Winslowiella iniecta B120 Isolate Aphididae
223 2651870110 Izhakiella capsodis N6PO6 Isolate Unclassified
224 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
225 2703719240 Serratia marcescens ano2 Isolate Unclassified
226 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
227 2864755708 Massilia timonae S00006 Isolate Elmidae
228 2871771314 Pantoea sp. Ae16 Isolate Culicidae
229 2885046828 Erwinia sp. OLCASP19 Isolate Anthocoridae
230 2885054481 Erwinia sp. OLMDSP33 Isolate Anthocoridae
231 2908136803 Vibrio owensii 1700302 Isolate Unclassified
232 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
233 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
234 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
235 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
236 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
237 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
238 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
239 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
240 648276708 Pantoea sp. aB Isolate Unclassified
241 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
242 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
243 8022345672 Vibrio sp. 070316B Isolate Unclassified
244 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
245 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
246 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
247 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
248 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
249 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
250 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
251 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
252 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
253 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
254 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
255 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
256 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
257 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
258 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
259 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
260 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
261 2684622551 Vibrio campbellii E1 Isolate Unclassified
262 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
263 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
264 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
265 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
266 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
267 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
268 2862784999 Streptomyces sp. M41 Isolate Unclassified
269 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
270 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
271 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
272 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
273 2885058212 Erwinia sp. OLTSP20 Isolate Anthocoridae
274 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
275 2901296437 Erwinia dacicola Oroville Isolate Tephritidae
276 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
277 637000270 Sodalis glossinidius morsitans Isolate Glossinidae
278 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
279 8022096067 Vibrio sp. SALL6 Isolate Unclassified
280 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
281 8051461712 Vibrio vulnificus Vv002 Isolate
282 8060845732 Vibrio vulnificus Vv006 Isolate
283 8071343737 Escherichia coli PN119 Isolate Calliphoridae
284 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
285 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
286 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
287 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
288 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
289 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
290 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
291 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
292 3300005317 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut Metagenome Drosophilidae
293 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
294 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
295 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
296 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
297 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
298 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
299 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_085767 3300042601 Bacteria 92057
2 Ga0466719_517123 3300042606 Unclassified 2057
3 Ga0466722_005904 3300042609 Bacteria 6210
4 Ga0466722_152018 3300042609 Bacteria 2053
5 Ga0562379_0681 3300056790 Unclassified 57878
6 Ga0123355_11540254 3300009826 Unclassified 645
7 Ga0160431_100018 3300012828 Bacteria 173296
8 Ga0466657_100834 3300042582 Bacteria 2810
9 Ga0466690_141895 3300042590 Unclassified 1806
10 Ga0466692_115808 3300042591 Bacteria 16044
11 Ga0466691_027086 3300042593 Bacteria 3858
12 IMNBGM34_c000015 3300000036 Bacteria 47738
13 HBC_ctgsDRAFT_1004467 3300000333 Bacteria 3244
14 HBC_ctgsDRAFT_1011070 3300000333 Bacteria 2154
15 Ga0072941_1321794 3300005201 Bacteria 1163
16 Ga0105008_1097230 3300007507 Unclassified 2143
17 Ga0466711_138047 3300042615 Bacteria 1266
18 Ga0466715_128452 3300042616 Bacteria 25205
19 Ga0466715_338967 3300042616 Bacteria 15425
20 Ga0466726_178713 3300042619 Bacteria 5875
21 Ga0466729_090361 3300042621 Bacteria 1125
22 Ga0466731_173710 3300042622 Bacteria 5283
23 Ga0466704_480324 3300042643 Bacteria 57822
24 Ga0466709_390481 3300042648 Bacteria 2429
25 Ga0466707_107166 3300042601 Bacteria 11000
26 Ga0466707_302721 3300042601 Bacteria 3772
27 Ga0466713_122277 3300042602 Bacteria 18801
28 Ga0466719_292771 3300042606 Unclassified 1676
29 Ga0562379_4621 3300056790 Bacteria 6587
30 Ga0562379_4728 3300056790 Unclassified 6272
31 Ga0562375_0229 3300056856 Unclassified 154884
32 Ga0562374_0091 3300057007 Bacteria 255104
33 Ga0123356_10001231 3300010049 Bacteria 28442
34 Ga0123356_10004577 3300010049 Unclassified 14256
35 Ga0123356_13233935 3300010049 Bacteria 567
36 Ga0123354_10025493 3300010882 Bacteria 9323
37 Ga0160442_109005 3300012806 Bacteria 922
38 Ga0160470_101166 3300012813 Bacteria 6909
39 Ga0265387_1000829 3300024582 Unclassified 4702
40 IMNBGM34_c000054 3300000036 Bacteria 32127
41 IMNBGM34_c044271 3300000036 Unclassified 579
42 Ga0063521_1000022 3300003973 Bacteria 133586
43 Ga0063521_1000211 3300003973 Bacteria 41476
44 Ga0102737_1000393 3300007142 Bacteria 14743
45 Ga0103264_1000103 3300007188 Bacteria 95820
46 Ga0103264_1012825 3300007188 Bacteria 4111
47 Ga0103264_1024331 3300007188 Unclassified 4955
48 Ga0105005_1017544 3300007505 Bacteria 19255
49 Ga0105008_1093452 3300007507 Unclassified 2027
50 Ga0466715_162141 3300042616 Bacteria 1240
51 Ga0466715_357109 3300042616 Bacteria 17968
52 Ga0466728_330894 3300042620 Bacteria 2188
53 Ga0466734_060661 3300042623 Bacteria 37945
54 Ga0466734_107392 3300042623 Bacteria 3204
55 Ga0466704_070839 3300042643 Bacteria 1990
56 Ga0466704_234613 3300042643 Bacteria 1322
57 Ga0466724_00951 3300042649 Unclassified 13465
58 Ga0466708_043725 3300042652 Bacteria 17261
59 Ga0466707_024269 3300042601 Bacteria 18210
60 Ga0466716_400646 3300042605 Bacteria 1157
61 Ga0466722_121307 3300042609 Bacteria 1328
62 Ga0530661_000762 3300056564 Unclassified 20761
63 Ga0123354_10000052 3300010882 Bacteria 88097
64 Ga0466657_016905 3300042582 Bacteria 1259
65 Ga0466657_091603 3300042582 Bacteria 1144
66 Ga0466657_185230 3300042582 Bacteria 1119
67 Ga0466657_289336 3300042582 Bacteria 8238
68 Ga0466690_274886 3300042590 Bacteria 3366
69 Ga0466696_051662 3300042596 Bacteria 9998
70 IMNBGM34_c000261 3300000036 Bacteria 15218
71 IMNBGM34_c002273 3300000036 Bacteria 2860
72 JGI24696J40584_12939875 3300002834 Unclassified 1663
73 CVPL005W_1000080 3300002934 Bacteria 37325
74 Ga0466715_102112 3300042616 Bacteria 1317
75 Ga0466723_045341 3300042618 Bacteria 29933
76 Ga0466723_125499 3300042618 Bacteria 1263
77 Ga0466723_195165 3300042618 Bacteria 2265
78 Ga0466705_369077 3300042612 Unclassified 44107
79 Ga0466735_102806 3300042624 Bacteria 2642
80 Ga0466709_163755 3300042648 Bacteria 13399
81 Ga0466724_61555 3300042649 Unclassified 12942
82 Ga0466707_208432 3300042601 Unclassified 3532
83 Ga0466713_064983 3300042602 Bacteria 2074
84 Ga0466713_152207 3300042602 Bacteria 1094
85 Ga0466719_112674 3300042606 Bacteria 2225
86 Ga0123356_10140157 3300010049 Bacteria 2384
87 Ga0160471_108545 3300012812 Unclassified 1189
88 Ga0160455_100051 3300012837 Bacteria 249063
89 Ga0466690_069916 3300042590 Bacteria 3135
90 IMNBGM34_c013878 3300000036 Bacteria 1007
91 Ga0466710_095352 3300042613 Bacteria 3541
92 Ga0466726_337541 3300042619 Bacteria 1009
93 Ga0466703_297825 3300042636 Bacteria 8070
94 Ga0466704_274392 3300042643 Unclassified 8106
95 Ga0466704_476609 3300042643 Bacteria 3896
96 Ga0466708_129182 3300042652 Bacteria 7620
97 Ga0466725_365387 3300042654 Bacteria 33756
98 Ga0466707_112432 3300042601 Bacteria 3033
99 Ga0466707_235278 3300042601 Unclassified 8046
100 Ga0466707_264074 3300042601 Bacteria 1601
101 Ga0466719_147814 3300042606 Bacteria 6222
102 Ga0466722_008217 3300042609 Unclassified 1498
103 Ga0466733_196082 3300042659 Bacteria 37545
104 Ga0123356_10385320 3300010049 Unclassified 1535
105 Ga0160472_100232 3300012839 Bacteria 66467
106 Ga0160448_100022 3300012854 Bacteria 202960
107 Ga0466657_297072 3300042582 Bacteria 1812
108 Ga0466692_106049 3300042591 Bacteria 2195
109 Ga0466692_179382 3300042591 Bacteria 27457
110 Ga0466691_221612 3300042593 Bacteria 1688
111 JGI24695J34938_10094917 3300002450 Bacteria 1222
112 JGI24702J35022_10001526 3300002462 Bacteria 14369
113 Ga0063521_1000049 3300003973 Bacteria 105543
114 Ga0104042_1038561 3300007130 Unclassified 1826
115 Ga0466705_394169 3300042612 Bacteria 1468
116 Ga0466723_068598 3300042618 Bacteria 5548
117 Ga0466705_150060 3300042612 Bacteria 4042
118 Ga0466705_365037 3300042612 Unclassified 2046
119 Ga0466729_293111 3300042621 Bacteria 2326
120 Ga0466703_411926 3300042636 Unclassified 5881
121 Ga0466704_537859 3300042643 Unclassified 8170
122 Ga0466709_017161 3300042648 Bacteria 1268
123 Ga0466708_102826 3300042652 Bacteria 39124
124 Ga0466725_107158 3300042654 Bacteria 6510
125 Ga0466725_397386 3300042654 Unclassified 2784
126 Ga0466701_059753 3300042598 Bacteria 6405
127 Ga0466707_050802 3300042601 Bacteria 7866
128 Ga0466707_211324 3300042601 Bacteria 4512
129 Ga0466713_070399 3300042602 Bacteria 88794
130 Ga0466719_063811 3300042606 Bacteria 12327
131 Ga0466719_134778 3300042606 Bacteria 1115
132 Ga0466719_342730 3300042606 Bacteria 2403
133 Ga0466719_354029 3300042606 Bacteria 1209
134 Ga0466722_069801 3300042609 Bacteria 2809
135 Ga0466722_243125 3300042609 Bacteria 10434
136 Ga0562375_0065 3300056856 Bacteria 412749
137 Ga0123353_10000212 3300010167 Bacteria 73953
138 Ga0160436_1010039 3300012861 Unclassified 2071
139 Ga0466692_049838 3300042591 Bacteria 185020
140 FGTW_contig31706 2065487013 Unclassified 3523
141 Meta3P_1000347 3300002464 Unclassified 24826
142 Ga0074188_1000220 3300005318 Bacteria 34540
143 Ga0102736_1001341 3300007052 Bacteria 4336
144 Ga0103264_1000032 3300007188 Bacteria 148835
145 Ga0123357_10000011 3300009784 Bacteria 173575
146 Ga0466710_020131 3300042613 Bacteria 1255
147 Ga0466726_282636 3300042619 Bacteria 16987
148 Ga0466728_140024 3300042620 Bacteria 4688
149 Ga0466705_173682 3300042612 Bacteria 11802
150 Ga0466730_031437 3300042625 Unclassified 37757
151 Ga0466702_239735 3300042635 Bacteria 18941
152 Ga0466703_403352 3300042636 Bacteria 1193
153 Ga0466704_161690 3300042643 Bacteria 5738
154 Ga0466713_065172 3300042602 Bacteria 2046
155 Ga0466717_183607 3300042604 Bacteria 9559
156 Ga0466716_059639 3300042605 Bacteria 48128
157 Ga0466719_226197 3300042606 Bacteria 4738
158 Ga0466719_270473 3300042606 Bacteria 2001
159 Ga0466722_093067 3300042609 Bacteria 25071
160 Ga0123357_10369183 3300009784 Bacteria 1347
161 Ga0123357_10418134 3300009784 Unclassified 1199
162 Ga0123355_10511117 3300009826 Bacteria 1476
163 Ga0123356_10064362 3300010049 Unclassified 3428
164 Ga0123354_10224554 3300010882 Bacteria 1984
165 Ga0160446_100480 3300012835 Unclassified 17315
166 Ga0466657_021650 3300042582 Bacteria 6609
167 Ga0466696_174978 3300042596 Bacteria 2976
168 DPOL_contig14637 2035918003 Bacteria 83088
169 CVPL005W_1000257 3300002934 Bacteria 23073
170 CVPL005L_10021790 3300002938 Bacteria 3072
171 Ga0074311_1190243 3300005317 Bacteria 539
172 Ga0074311_1192375 3300005317 Bacteria 529
173 Ga0105005_1024619 3300007505 Unclassified 2857
174 Ga0466715_250169 3300042616 Bacteria 28538
175 Ga0466718_117217 3300042617 Bacteria 1136
176 Ga0466726_293984 3300042619 Bacteria 1030
177 Ga0466728_338844 3300042620 Unclassified 3727
178 Ga0466728_419804 3300042620 Bacteria 3913
179 Ga0466729_298879 3300042621 Bacteria 94207
180 Ga0466734_012056 3300042623 Bacteria 25616
181 Ga0466703_153671 3300042636 Bacteria 1995
182 Ga0466703_234815 3300042636 Bacteria 52704
183 Ga0466724_56022 3300042649 Unclassified 14651
184 Ga0466708_212214 3300042652 Bacteria 5950
185 Ga0466701_046584 3300042598 Bacteria 6257
186 Ga0466701_050348 3300042598 Bacteria 1046
187 Ga0466707_131320 3300042601 Unclassified 1329
188 Ga0466719_300281 3300042606 Bacteria 2983
189 Ga0466721_027227 3300042608 Bacteria 5825
190 Ga0123356_10252620 3300010049 Unclassified 1842
191 Ga0316159_10604 3300030930 Bacteria 5343
192 Ga0466693_194500 3300042592 Bacteria 1740
193 Ga0466691_064617 3300042593 Bacteria 3055
194 Ga0466696_196374 3300042596 Bacteria 23288
195 Ga0072941_1430482 3300005201 Bacteria 829
196 Ga0104147_1016501 3300007224 Unclassified 15474
197 Ga0466710_007969 3300042613 Bacteria 6040
198 Ga0466711_110862 3300042615 Bacteria 20810
199 Ga0466726_425263 3300042619 Bacteria 15829
200 Ga0466728_388476 3300042620 Bacteria 2108
201 Ga0466729_071924 3300042621 Unclassified 1461
202 Ga0466705_110668 3300042612 Bacteria 1142
203 Ga0466734_002784 3300042623 Bacteria 5039
204 Ga0466734_100222 3300042623 Bacteria 1397
205 Ga0466709_417048 3300042648 Bacteria 14680
206 Ga0466725_149167 3300042654 Bacteria 121753
207 Ga0466727_151827 3300042655 Bacteria 15595

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00543 P-II Nitrogen regulatory protein P-II 1 107 0.94

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.