Protein Family IF07463
Metagenome
Isolate
205
Members
77
Samples
180
Scaffolds
283.31
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_062516|Ga0466711_062516_39_902
- Length
- 277 aa
- Sequence
- MDTQIKLFDNKQVRTLWNPGNEEWFFSVIDVIQVLTDSPNPRKYWSVLKTRMKAEGDETATNCNRLKMLAPDGKMRLTDVVDTQQLFRLIQSIPSPKAEPFKQWIALVAKERLDQLQDPELSIDQAMQDYKRLGYSDNWINQRLKSIEIRKELTSEWKARGVKEGPQFAFLTDIITKTWAGKTTKENLRDNMTNTELVLNMLAELSTKNISETSDPNSFQDHVNVAVQGGEIAKNARKELESKMGKSVVSQLNAHSGMMLGKGNEDADTVENVSDGS
Sample Types
Isolate
12.2%
Metagenome
87.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.1%
Blattidae
17.1%
Kalotermitidae
15.8%
Unclassified
13.2%
Rhinotermitidae
3.9%
Termopsidae
3.9%
Passalidae
2.6%
Hodotermitidae
1.3%
Taxonomy
Archaea
2
Bacteria
196
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 2820466401 | Unclassified Firmicutes Lab288P3bin111 | Isolate | Unclassified |
| 11 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 12 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 13 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 14 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 29 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 30 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 31 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 32 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 41 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 43 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 44 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 45 | 2820939604 | Unclassified Actinobacteria Emb289P1bin4 | Isolate | Unclassified |
| 46 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 51 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 52 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 53 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 54 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 55 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 56 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 57 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 58 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 59 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 60 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 61 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 62 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 63 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 64 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 65 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 66 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 67 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 68 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 69 | 2820497731 | Unclassified Firmicutes Lab288P1bin55 | Isolate | Unclassified |
| 70 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 71 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 72 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 73 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 74 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 75 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 76 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 77 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_162531 | 3300042656 | Bacteria | 2258 |
| 2 | Ga0466732_408424 | 3300042656 | Bacteria | 2772 |
| 3 | Ga0466657_196598 | 3300042582 | Bacteria | 1431 |
| 4 | Ga0466701_011617 | 3300042598 | Bacteria | 1086 |
| 5 | Ga0466731_042446 | 3300042622 | Bacteria | 1043 |
| 6 | Ga0466734_066578 | 3300042623 | Bacteria | 2098 |
| 7 | Ga0466734_089505 | 3300042623 | Bacteria | 3976 |
| 8 | Ga0466700_068155 | 3300042600 | Bacteria | 6789 |
| 9 | Ga0466713_134860 | 3300042602 | Bacteria | 1542 |
| 10 | Ga0466698_041143 | 3300042610 | Bacteria | 3326 |
| 11 | Ga0466698_213150 | 3300042610 | Bacteria | 2243 |
| 12 | Ga0123355_10010119 | 3300009826 | Unclassified | 14415 |
| 13 | Ga0123356_10316334 | 3300010049 | Bacteria | 1672 |
| 14 | Ga0123353_10001132 | 3300010167 | Bacteria | 32461 |
| 15 | Ga0123353_10316050 | 3300010167 | Bacteria | 2373 |
| 16 | Ga0123354_10381572 | 3300010882 | Bacteria | 1216 |
| 17 | Ga0123354_10381578 | 3300010882 | Bacteria | 1216 |
| 18 | IMNBL1DRAFT_c0030145 | 3300000062 | Bacteria | 1994 |
| 19 | JGI24702J35022_10010510 | 3300002462 | Bacteria | 5166 |
| 20 | JGI24702J35022_10050826 | 3300002462 | Bacteria | 2209 |
| 21 | JGI24703J35330_11422278 | 3300002501 | Bacteria | 990 |
| 22 | JGI24705J35276_12195824 | 3300002504 | Bacteria | 1531 |
| 23 | Ga0265387_1020881 | 3300024582 | Bacteria | 981 |
| 24 | Ga0466657_051357 | 3300042582 | Bacteria | 3529 |
| 25 | Ga0466690_116610 | 3300042590 | Bacteria | 1198 |
| 26 | Ga0466693_045882 | 3300042592 | Bacteria | 1146 |
| 27 | Ga0466711_198639 | 3300042615 | Bacteria | 16825 |
| 28 | Ga0466703_087899 | 3300042636 | Bacteria | 7337 |
| 29 | Ga0466725_251675 | 3300042654 | Bacteria | 3507 |
| 30 | Ga0466727_025603 | 3300042655 | Bacteria | 9184 |
| 31 | Ga0466706_262534 | 3300042599 | Bacteria | 3905 |
| 32 | Ga0466707_236570 | 3300042601 | Bacteria | 25314 |
| 33 | Ga0466707_406067 | 3300042601 | Unclassified | 1034 |
| 34 | Ga0123356_10659270 | 3300010049 | Bacteria | 1214 |
| 35 | Ga0123356_10711020 | 3300010049 | Bacteria | 1174 |
| 36 | Ga0123353_10000056 | 3300010167 | Bacteria | 127423 |
| 37 | Ga0123353_10058586 | 3300010167 | Bacteria | 6172 |
| 38 | JGI24703J35330_11654666 | 3300002501 | Bacteria | 1619 |
| 39 | JGI24705J35276_12199800 | 3300002504 | Bacteria | 1591 |
| 40 | JGI24696J40584_12957901 | 3300002834 | Bacteria | 3760 |
| 41 | Ga0466733_218576 | 3300042659 | Bacteria | 2237 |
| 42 | Ga0466696_259749 | 3300042596 | Bacteria | 1342 |
| 43 | Ga0466711_062516 | 3300042615 | Bacteria | 1424 |
| 44 | Ga0466711_368582 | 3300042615 | Bacteria | 2451 |
| 45 | Ga0466718_015227 | 3300042617 | Bacteria | 1148 |
| 46 | Ga0466723_068789 | 3300042618 | Bacteria | 1750 |
| 47 | Ga0466726_487697 | 3300042619 | Bacteria | 1139 |
| 48 | Ga0466729_235914 | 3300042621 | Bacteria | 6418 |
| 49 | Ga0466731_212606 | 3300042622 | Bacteria | 1203 |
| 50 | Ga0466709_189491 | 3300042648 | Bacteria | 2269 |
| 51 | Ga0466709_258941 | 3300042648 | Unclassified | 2125 |
| 52 | Ga0466709_300676 | 3300042648 | Bacteria | 5772 |
| 53 | Ga0466724_52668 | 3300042649 | Bacteria | 6255 |
| 54 | Ga0466725_224080 | 3300042654 | Bacteria | 5182 |
| 55 | Ga0466727_022167 | 3300042655 | Bacteria | 4448 |
| 56 | Ga0466727_269285 | 3300042655 | Bacteria | 1119 |
| 57 | Ga0466713_062146 | 3300042602 | Bacteria | 1694 |
| 58 | Ga0466713_105750 | 3300042602 | Bacteria | 4349 |
| 59 | Ga0466714_022371 | 3300042603 | Bacteria | 13381 |
| 60 | Ga0466716_545542 | 3300042605 | Bacteria | 6508 |
| 61 | Ga0123357_10335940 | 3300009784 | Bacteria | 1469 |
| 62 | Ga0123356_10181086 | 3300010049 | Bacteria | 2129 |
| 63 | Ga0123353_10026550 | 3300010167 | Bacteria | 8849 |
| 64 | Ga0123354_10108621 | 3300010882 | Unclassified | 3683 |
| 65 | Ga0123354_10182003 | 3300010882 | Bacteria | 2394 |
| 66 | Ga0123354_10228834 | 3300010882 | Bacteria | 1950 |
| 67 | Ga0123354_10263916 | 3300010882 | Bacteria | 1712 |
| 68 | 2227513833 | 2225789004 | Bacteria | 3493 |
| 69 | IMNBL1DRAFT_c0003578 | 3300000062 | Bacteria | 9862 |
| 70 | JGI24702J35022_10002329 | 3300002462 | Bacteria | 11619 |
| 71 | JGI24702J35022_10077215 | 3300002462 | Bacteria | 1801 |
| 72 | Ga0466692_027543 | 3300042591 | Bacteria | 2705 |
| 73 | Ga0466712_010261 | 3300042614 | Bacteria | 1266 |
| 74 | Ga0466735_066785 | 3300042624 | Bacteria | 1123 |
| 75 | Ga0466727_321823 | 3300042655 | Bacteria | 3422 |
| 76 | Ga0466701_020541 | 3300042598 | Bacteria | 3086 |
| 77 | Ga0466717_008013 | 3300042604 | Bacteria | 3981 |
| 78 | Ga0466717_041621 | 3300042604 | Archaea | 2336 |
| 79 | Ga0466716_134696 | 3300042605 | Bacteria | 5548 |
| 80 | Ga0123356_10006710 | 3300010049 | Bacteria | 11596 |
| 81 | Ga0123353_10167994 | 3300010167 | Bacteria | 3485 |
| 82 | 2227474661 | 2225789004 | Bacteria | 4703 |
| 83 | IMNBL1DRAFT_c0033246 | 3300000062 | Bacteria | 1849 |
| 84 | JGI24705J35276_12040402 | 3300002504 | Bacteria | 902 |
| 85 | JGI24696J40584_12954744 | 3300002834 | Bacteria | 2698 |
| 86 | Ga0466693_058898 | 3300042592 | Unclassified | 1720 |
| 87 | Ga0466696_139527 | 3300042596 | Bacteria | 7738 |
| 88 | Ga0466699_077443 | 3300042597 | Bacteria | 1256 |
| 89 | Ga0466699_105326 | 3300042597 | Bacteria | 1456 |
| 90 | Ga0466715_311539 | 3300042616 | Bacteria | 6664 |
| 91 | Ga0466718_099615 | 3300042617 | Bacteria | 3707 |
| 92 | Ga0466726_208534 | 3300042619 | Bacteria | 1704 |
| 93 | Ga0466734_144071 | 3300042623 | Bacteria | 1705 |
| 94 | Ga0466709_012452 | 3300042648 | Bacteria | 5299 |
| 95 | Ga0466709_226560 | 3300042648 | Bacteria | 11549 |
| 96 | Ga0466701_090702 | 3300042598 | Bacteria | 2861 |
| 97 | Ga0466707_069447 | 3300042601 | Bacteria | 11354 |
| 98 | Ga0466714_023561 | 3300042603 | Bacteria | 53847 |
| 99 | Ga0466719_497508 | 3300042606 | Bacteria | 8816 |
| 100 | Ga0466719_523621 | 3300042606 | Bacteria | 4328 |
| 101 | Ga0466721_137670 | 3300042608 | Bacteria | 16910 |
| 102 | Ga0123356_10001083 | 3300010049 | Bacteria | 30163 |
| 103 | Ga0123356_10071180 | 3300010049 | Bacteria | 3264 |
| 104 | Ga0123353_10032000 | 3300010167 | Bacteria | 8162 |
| 105 | Ga0123353_10601611 | 3300010167 | Bacteria | 1571 |
| 106 | Ga0123353_10708694 | 3300010167 | Bacteria | 1411 |
| 107 | Ga0123353_11237045 | 3300010167 | Bacteria | 976 |
| 108 | JGI24702J35022_10146961 | 3300002462 | Bacteria | 1320 |
| 109 | JGI24705J35276_12154114 | 3300002504 | Bacteria | 1198 |
| 110 | Ga0466705_238434 | 3300042612 | Bacteria | 4345 |
| 111 | Ga0466656_108789 | 3300042550 | Bacteria | 1265 |
| 112 | Ga0466657_189842 | 3300042582 | Bacteria | 2955 |
| 113 | Ga0466657_300899 | 3300042582 | Bacteria | 1040 |
| 114 | Ga0466726_164026 | 3300042619 | Bacteria | 16878 |
| 115 | Ga0466731_359954 | 3300042622 | Bacteria | 1321 |
| 116 | Ga0466735_122063 | 3300042624 | Bacteria | 7441 |
| 117 | Ga0466730_017594 | 3300042625 | Bacteria | 12276 |
| 118 | Ga0466703_071612 | 3300042636 | Bacteria | 4352 |
| 119 | Ga0466703_233120 | 3300042636 | Bacteria | 2002 |
| 120 | Ga0466709_314545 | 3300042648 | Bacteria | 211401 |
| 121 | Ga0466709_414345 | 3300042648 | Bacteria | 3945 |
| 122 | Ga0466724_59723 | 3300042649 | Bacteria | 3792 |
| 123 | Ga0466706_116586 | 3300042599 | Bacteria | 50579 |
| 124 | Ga0466700_119831 | 3300042600 | Bacteria | 20318 |
| 125 | Ga0466707_303142 | 3300042601 | Bacteria | 1141 |
| 126 | Ga0466713_026884 | 3300042602 | Bacteria | 64226 |
| 127 | Ga0466713_039191 | 3300042602 | Bacteria | 1211 |
| 128 | Ga0466714_009754 | 3300042603 | Bacteria | 3218 |
| 129 | Ga0466717_108348 | 3300042604 | Bacteria | 3827 |
| 130 | Ga0466721_077021 | 3300042608 | Bacteria | 1174 |
| 131 | Ga0123353_10027686 | 3300010167 | Archaea | 8691 |
| 132 | Ga0123353_10049135 | 3300010167 | Bacteria | 6719 |
| 133 | IMNBL1DRAFT_c0062639 | 3300000062 | Bacteria | 1110 |
| 134 | JGI24695J34938_10009185 | 3300002450 | Bacteria | 5522 |
| 135 | JGI24702J35022_10085576 | 3300002462 | Bacteria | 1712 |
| 136 | Ga0466705_077474 | 3300042612 | Bacteria | 22383 |
| 137 | Ga0466705_206311 | 3300042612 | Bacteria | 1992 |
| 138 | Ga0466705_456285 | 3300042612 | Bacteria | 1224 |
| 139 | Ga0466734_173568 | 3300042623 | Bacteria | 1337 |
| 140 | Ga0466702_065454 | 3300042635 | Bacteria | 1767 |
| 141 | Ga0466702_104819 | 3300042635 | Bacteria | 1993 |
| 142 | Ga0466725_172502 | 3300042654 | Bacteria | 4475 |
| 143 | Ga0466725_463015 | 3300042654 | Bacteria | 3020 |
| 144 | Ga0466706_114959 | 3300042599 | Bacteria | 66212 |
| 145 | Ga0466700_241304 | 3300042600 | Bacteria | 12215 |
| 146 | Ga0466707_415150 | 3300042601 | Bacteria | 1193 |
| 147 | Ga0466713_078961 | 3300042602 | Bacteria | 1331 |
| 148 | Ga0466714_095498 | 3300042603 | Bacteria | 2935 |
| 149 | Ga0123356_10000479 | 3300010049 | Bacteria | 44749 |
| 150 | Ga0123356_10112021 | 3300010049 | Bacteria | 2638 |
| 151 | Ga0123356_10472061 | 3300010049 | Bacteria | 1406 |
| 152 | Ga0123353_10030170 | 3300010167 | Bacteria | 8374 |
| 153 | JGI24702J35022_10223580 | 3300002462 | Bacteria | 1086 |
| 154 | Ga0466697_187871 | 3300042611 | Bacteria | 3423 |
| 155 | Ga0466697_256716 | 3300042611 | Bacteria | 1677 |
| 156 | Ga0466705_373980 | 3300042612 | Bacteria | 3947 |
| 157 | Ga0466656_234799 | 3300042550 | Bacteria | 1616 |
| 158 | Ga0466690_221590 | 3300042590 | Bacteria | 1311 |
| 159 | Ga0466690_384650 | 3300042590 | Bacteria | 1984 |
| 160 | Ga0466692_081288 | 3300042591 | Bacteria | 6415 |
| 161 | Ga0466693_179114 | 3300042592 | Bacteria | 1574 |
| 162 | Ga0466694_008759 | 3300042594 | Bacteria | 11267 |
| 163 | Ga0466696_461997 | 3300042596 | Bacteria | 7768 |
| 164 | Ga0466705_435529 | 3300042612 | Bacteria | 1177 |
| 165 | Ga0466726_230751 | 3300042619 | Bacteria | 3152 |
| 166 | Ga0466729_171980 | 3300042621 | Bacteria | 5374 |
| 167 | Ga0466704_432101 | 3300042643 | Unclassified | 2088 |
| 168 | Ga0466708_193415 | 3300042652 | Bacteria | 6661 |
| 169 | Ga0466727_215847 | 3300042655 | Bacteria | 1672 |
| 170 | Ga0466701_054895 | 3300042598 | Bacteria | 2669 |
| 171 | Ga0466714_150303 | 3300042603 | Bacteria | 28075 |
| 172 | Ga0466722_092450 | 3300042609 | Bacteria | 1325 |
| 173 | Ga0123357_10396757 | 3300009784 | Bacteria | 1260 |
| 174 | Ga0123356_10286153 | 3300010049 | Bacteria | 1746 |
| 175 | Ga0123356_10335932 | 3300010049 | Bacteria | 1629 |
| 176 | Ga0123354_10259278 | 3300010882 | Bacteria | 1741 |
| 177 | IMNBL1DRAFT_c0044340 | 3300000062 | Bacteria | 1462 |
| 178 | JGI24695J34938_10017928 | 3300002450 | Unclassified | 3555 |
| 179 | JGI24705J35276_12121012 | 3300002504 | Bacteria | 1072 |
| 180 | JGI24696J40584_12961100 | 3300002834 | Bacteria | 10713 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02498 | Bro-N | BRO family, N-terminal domain | 12 | 106 | 0.76 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.