Protein Family IF07438
Metagenome
Isolate
303
Members
98
Samples
263
Scaffolds
362.49
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_322623|Ga0466712_322623_2339_3607
- Length
- 411 aa
- Sequence
- MPILGESVNCKRADGKGTGRIYKQVQHKMKNTANSGNTAIDHQWANVHNKAMKAGIIGATGYAGAELIRLLSGHPEINELILSSVSFEGGRIEDVYPNFLGRVSCPLLKAEDVVASSDVVFAALPHGIGEPFAAACMERKIHYIDLSADFRFDDDEAVYSAWYGKPYRYPELRKNSVKELAAAGPVIIGNPGCYPTGGSLGVFPALAKGLVCPERPVIVDAVSGTSGGGREPSRSFHYPECADSVSPYKVASHRHSPEIARNFAAMAAAGGTPSPQMIFTPHLAPLNRGILSTIYIPLSGEWRVAAGGAVMPPSKEIEVMTDKIRSLYDDFYRDEPFVRVLPAGLTAATNRVRQSNYCDISVHLDLNGSTLIAAGAIDNMVKGAAGQAIQNMNILFGFDEKAGLEAIPALF
Sample Types
Isolate
13.2%
Metagenome
86.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.2%
Unclassified
29.2%
Blattidae
14.6%
Kalotermitidae
13.5%
Passalidae
3.1%
Termopsidae
3.1%
Rhinotermitidae
3.1%
Armadillidiidae
1.0%
Hodotermitidae
1.0%
Tenebrionidae
1.0%
Taxonomy
Archaea
2
Bacteria
285
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 2 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 3 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 4 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 5 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 6 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 7 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 14 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 15 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 16 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 17 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 18 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 19 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 26 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 27 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 28 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 29 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 30 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 31 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 32 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 35 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 36 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 37 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 38 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 44 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 45 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 46 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 47 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 50 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 51 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 52 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 53 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 54 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 55 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 56 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 57 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 58 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 59 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 60 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 61 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 62 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 63 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 64 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 65 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 66 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 67 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 68 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 69 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 70 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 71 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 72 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 73 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 74 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 75 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 76 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 77 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 78 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 79 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 80 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 81 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 82 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 83 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 84 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 85 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 86 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 87 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 88 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 89 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 90 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 91 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 92 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 93 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 94 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 95 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 96 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 97 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 98 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 2 | Ga0415639_034101 | 3300038395 | Bacteria | 23082 |
| 3 | Ga0415639_058345 | 3300038395 | Bacteria | 2560 |
| 4 | Ga0466692_193582 | 3300042591 | Bacteria | 3839 |
| 5 | Ga0466694_068592 | 3300042594 | Archaea | 1745 |
| 6 | Ga0466694_140512 | 3300042594 | Bacteria | 34095 |
| 7 | Ga0466703_030391 | 3300042636 | Bacteria | 5300 |
| 8 | Ga0466708_024284 | 3300042652 | Bacteria | 13484 |
| 9 | Ga0466708_362189 | 3300042652 | Bacteria | 14207 |
| 10 | Ga0466708_438643 | 3300042652 | Bacteria | 1689 |
| 11 | Ga0466720_017748 | 3300042607 | Bacteria | 2732 |
| 12 | Ga0466720_029011 | 3300042607 | Bacteria | 19425 |
| 13 | 2227097477 | 2225789004 | Bacteria | 9690 |
| 14 | 2227494069 | 2225789004 | Unclassified | 20288 |
| 15 | IMNBL1DRAFT_c0000287 | 3300000062 | Bacteria | 44153 |
| 16 | AustNasuHG_c1000171 | 3300000089 | Bacteria | 21002 |
| 17 | JGI24698J34947_10008523 | 3300002449 | Bacteria | 5629 |
| 18 | JGI24698J34947_10016986 | 3300002449 | Bacteria | 3948 |
| 19 | JGI24698J34947_10024435 | 3300002449 | Bacteria | 3226 |
| 20 | JGI24695J34938_10000317 | 3300002450 | Bacteria | 47269 |
| 21 | JGI24695J34938_10000346 | 3300002450 | Bacteria | 45617 |
| 22 | JGI24695J34938_10000439 | 3300002450 | Bacteria | 40122 |
| 23 | JGI24702J35022_10005824 | 3300002462 | Bacteria | 7169 |
| 24 | Ga0072941_1004833 | 3300005201 | Bacteria | 19559 |
| 25 | Ga0123356_10003188 | 3300010049 | Bacteria | 17233 |
| 26 | Ga0123353_10185642 | 3300010167 | Bacteria | 3288 |
| 27 | Ga0123353_10266494 | 3300010167 | Bacteria | 2642 |
| 28 | Ga0466712_056692 | 3300042614 | Bacteria | 9705 |
| 29 | Ga0466712_322623 | 3300042614 | Bacteria | 21024 |
| 30 | Ga0466711_060850 | 3300042615 | Archaea | 1501 |
| 31 | Ga0466715_114864 | 3300042616 | Bacteria | 21180 |
| 32 | Ga0466718_016977 | 3300042617 | Bacteria | 3939 |
| 33 | Ga0466718_043344 | 3300042617 | Bacteria | 2201 |
| 34 | Ga0466723_185958 | 3300042618 | Bacteria | 5804 |
| 35 | Ga0264413_119482 | 3300024493 | Bacteria | 4229 |
| 36 | Ga0415639_178085 | 3300038395 | Bacteria | 3788 |
| 37 | Ga0466694_119017 | 3300042594 | Bacteria | 8275 |
| 38 | Ga0466694_246631 | 3300042594 | Bacteria | 3932 |
| 39 | Ga0466699_342096 | 3300042597 | Bacteria | 5573 |
| 40 | Ga0466699_440649 | 3300042597 | Bacteria | 11446 |
| 41 | Ga0466730_017327 | 3300042625 | Bacteria | 2182 |
| 42 | Ga0466703_025309 | 3300042636 | Bacteria | 15107 |
| 43 | Ga0466709_060582 | 3300042648 | Bacteria | 34862 |
| 44 | Ga0466727_308116 | 3300042655 | Bacteria | 1825 |
| 45 | Ga0466707_404097 | 3300042601 | Bacteria | 8334 |
| 46 | Ga0466720_029434 | 3300042607 | Bacteria | 25102 |
| 47 | Ga0466721_141243 | 3300042608 | Bacteria | 3278 |
| 48 | 2226982348 | 2225789003 | Unclassified | 1892 |
| 49 | AustNasuHG_c1002224 | 3300000089 | Bacteria | 7002 |
| 50 | JGI24698J34947_10014320 | 3300002449 | Bacteria | 4319 |
| 51 | JGI24698J34947_10016388 | 3300002449 | Bacteria | 4023 |
| 52 | JGI24695J34938_10000791 | 3300002450 | Bacteria | 29479 |
| 53 | JGI24695J34938_10001243 | 3300002450 | Bacteria | 22394 |
| 54 | JGI24695J34938_10002225 | 3300002450 | Bacteria | 15073 |
| 55 | JGI24700J35501_10926619 | 3300002508 | Bacteria | 6360 |
| 56 | Ga0068305_10001163 | 3300005083 | Unclassified | 31824 |
| 57 | Ga0074263_117289 | 3300005485 | Bacteria | 2330 |
| 58 | Ga0123356_10030889 | 3300010049 | Bacteria | 5012 |
| 59 | Ga0466712_150653 | 3300042614 | Bacteria | 6244 |
| 60 | Ga0466715_454892 | 3300042616 | Bacteria | 75769 |
| 61 | Ga0466718_015162 | 3300042617 | Bacteria | 17755 |
| 62 | Ga0466718_033801 | 3300042617 | Unclassified | 4651 |
| 63 | Ga0466718_072123 | 3300042617 | Bacteria | 3195 |
| 64 | Ga0466718_101564 | 3300042617 | Bacteria | 17321 |
| 65 | Ga0466705_322567 | 3300042612 | Bacteria | 1435 |
| 66 | Ga0466732_364352 | 3300042656 | Bacteria | 25000 |
| 67 | Ga0466733_043092 | 3300042659 | Bacteria | 2939 |
| 68 | Ga0264413_102090 | 3300024493 | Bacteria | 6033 |
| 69 | Ga0264413_108560 | 3300024493 | Bacteria | 5782 |
| 70 | Ga0415639_056431 | 3300038395 | Bacteria | 5316 |
| 71 | Ga0466692_082436 | 3300042591 | Bacteria | 4538 |
| 72 | Ga0466694_044199 | 3300042594 | Bacteria | 67264 |
| 73 | Ga0466694_162042 | 3300042594 | Bacteria | 1244 |
| 74 | Ga0466699_031950 | 3300042597 | Bacteria | 11308 |
| 75 | Ga0466699_317841 | 3300042597 | Bacteria | 21321 |
| 76 | Ga0466699_325518 | 3300042597 | Bacteria | 3765 |
| 77 | Ga0466731_336999 | 3300042622 | Bacteria | 12763 |
| 78 | Ga0466702_256683 | 3300042635 | Bacteria | 4988 |
| 79 | Ga0466703_182820 | 3300042636 | Bacteria | 2114 |
| 80 | Ga0466704_050409 | 3300042643 | Bacteria | 15467 |
| 81 | Ga0466709_043440 | 3300042648 | Unclassified | 25124 |
| 82 | Ga0466706_025250 | 3300042599 | Bacteria | 6630 |
| 83 | Ga0466720_042076 | 3300042607 | Bacteria | 12048 |
| 84 | Ga0466720_067831 | 3300042607 | Bacteria | 4442 |
| 85 | Ga0466721_224720 | 3300042608 | Bacteria | 20051 |
| 86 | Ga0466722_065765 | 3300042609 | Bacteria | 3247 |
| 87 | 2227600756 | 2225789004 | Bacteria | 2339 |
| 88 | IMNBL1DRAFT_c0000007 | 3300000062 | Bacteria | 246638 |
| 89 | AustNasuHG_c1002810 | 3300000089 | Bacteria | 6289 |
| 90 | JGI24698J34947_10026530 | 3300002449 | Bacteria | 3078 |
| 91 | JGI24695J34938_10014098 | 3300002450 | Bacteria | 4162 |
| 92 | JGI24695J34938_10014129 | 3300002450 | Bacteria | 4156 |
| 93 | JGI24695J34938_10028620 | 3300002450 | Unclassified | 2616 |
| 94 | Ga0072940_1004918 | 3300005200 | Bacteria | 32026 |
| 95 | Ga0072941_1006884 | 3300005201 | Bacteria | 8809 |
| 96 | Ga0072941_1047947 | 3300005201 | Bacteria | 12703 |
| 97 | Ga0123356_10000993 | 3300010049 | Bacteria | 31501 |
| 98 | Ga0123356_10274065 | 3300010049 | Bacteria | 1778 |
| 99 | Ga0123356_10325234 | 3300010049 | Bacteria | 1652 |
| 100 | Ga0123353_10268809 | 3300010167 | Bacteria | 2628 |
| 101 | Ga0466712_001003 | 3300042614 | Bacteria | 8071 |
| 102 | Ga0466712_092894 | 3300042614 | Bacteria | 11835 |
| 103 | Ga0466712_131204 | 3300042614 | Bacteria | 11792 |
| 104 | Ga0466711_216359 | 3300042615 | Bacteria | 4323 |
| 105 | Ga0466723_067893 | 3300042618 | Bacteria | 5572 |
| 106 | Ga0466726_038191 | 3300042619 | Bacteria | 1843 |
| 107 | Ga0466728_052610 | 3300042620 | Bacteria | 8648 |
| 108 | Ga0466732_161233 | 3300042656 | Bacteria | 28180 |
| 109 | Ga0466732_183584 | 3300042656 | Bacteria | 9664 |
| 110 | Ga0466694_088537 | 3300042594 | Unclassified | 1339 |
| 111 | Ga0466694_123739 | 3300042594 | Bacteria | 6523 |
| 112 | Ga0466699_006864 | 3300042597 | Bacteria | 1711 |
| 113 | Ga0466699_190731 | 3300042597 | Bacteria | 21954 |
| 114 | Ga0466699_233013 | 3300042597 | Bacteria | 18719 |
| 115 | Ga0466699_304107 | 3300042597 | Bacteria | 3110 |
| 116 | Ga0466708_061723 | 3300042652 | Bacteria | 6075 |
| 117 | Ga0466720_017944 | 3300042607 | Bacteria | 63542 |
| 118 | Ga0466720_018391 | 3300042607 | Bacteria | 6613 |
| 119 | Ga0466720_088769 | 3300042607 | Bacteria | 4330 |
| 120 | Ga0466698_243055 | 3300042610 | Bacteria | 4916 |
| 121 | JGI24698J34947_10000357 | 3300002449 | Bacteria | 20410 |
| 122 | JGI24698J34947_10009173 | 3300002449 | Bacteria | 5427 |
| 123 | JGI24695J34938_10000747 | 3300002450 | Bacteria | 30531 |
| 124 | JGI24695J34938_10002518 | 3300002450 | Bacteria | 13880 |
| 125 | Ga0123356_10002372 | 3300010049 | Bacteria | 20189 |
| 126 | Ga0123356_10017272 | 3300010049 | Bacteria | 6866 |
| 127 | Ga0466712_038402 | 3300042614 | Bacteria | 5063 |
| 128 | Ga0466712_050664 | 3300042614 | Bacteria | 2912 |
| 129 | Ga0466712_069934 | 3300042614 | Bacteria | 8734 |
| 130 | Ga0466712_122177 | 3300042614 | Bacteria | 11287 |
| 131 | Ga0466712_124121 | 3300042614 | Bacteria | 9434 |
| 132 | Ga0466712_221264 | 3300042614 | Bacteria | 6027 |
| 133 | Ga0466712_297217 | 3300042614 | Bacteria | 2290 |
| 134 | Ga0466718_012981 | 3300042617 | Bacteria | 4711 |
| 135 | Ga0466718_019981 | 3300042617 | Bacteria | 9035 |
| 136 | Ga0466726_082562 | 3300042619 | Unclassified | 1837 |
| 137 | Ga0466732_131764 | 3300042656 | Bacteria | 2858 |
| 138 | Ga0466733_060184 | 3300042659 | Bacteria | 1792 |
| 139 | Ga0466733_213514 | 3300042659 | Bacteria | 14921 |
| 140 | Ga0264413_102376 | 3300024493 | Bacteria | 55459 |
| 141 | Ga0264413_108559 | 3300024493 | Bacteria | 7710 |
| 142 | Ga0466693_201504 | 3300042592 | Bacteria | 30786 |
| 143 | Ga0466691_178275 | 3300042593 | Bacteria | 4121 |
| 144 | Ga0466703_188523 | 3300042636 | Bacteria | 1522 |
| 145 | Ga0466704_516938 | 3300042643 | Bacteria | 11849 |
| 146 | Ga0466706_068038 | 3300042599 | Bacteria | 9298 |
| 147 | Ga0466707_309021 | 3300042601 | Bacteria | 12425 |
| 148 | Ga0466716_240811 | 3300042605 | Bacteria | 14259 |
| 149 | Ga0466719_195985 | 3300042606 | Bacteria | 2139 |
| 150 | Ga0466719_427629 | 3300042606 | Bacteria | 1466 |
| 151 | Ga0466720_029249 | 3300042607 | Bacteria | 17062 |
| 152 | Ga0466720_031099 | 3300042607 | Bacteria | 6358 |
| 153 | Ga0466720_084725 | 3300042607 | Bacteria | 7943 |
| 154 | JGI24698J34947_10013784 | 3300002449 | Bacteria | 4405 |
| 155 | JGI24695J34938_10025992 | 3300002450 | Bacteria | 2788 |
| 156 | Ga0072941_1010167 | 3300005201 | Bacteria | 20585 |
| 157 | Ga0072941_1033205 | 3300005201 | Bacteria | 6655 |
| 158 | Ga0123355_10206732 | 3300009826 | Bacteria | 2855 |
| 159 | Ga0123356_10000042 | 3300010049 | Bacteria | 135091 |
| 160 | Ga0123353_10279358 | 3300010167 | Bacteria | 2566 |
| 161 | Ga0466715_611487 | 3300042616 | Bacteria | 2058 |
| 162 | Ga0466718_047257 | 3300042617 | Bacteria | 39468 |
| 163 | Ga0264413_116381 | 3300024493 | Unclassified | 3034 |
| 164 | Ga0415639_083280 | 3300038395 | Bacteria | 9847 |
| 165 | Ga0466692_107466 | 3300042591 | Bacteria | 6261 |
| 166 | Ga0466694_023028 | 3300042594 | Bacteria | 61948 |
| 167 | Ga0466695_061335 | 3300042595 | Bacteria | 29701 |
| 168 | Ga0466696_300398 | 3300042596 | Bacteria | 11321 |
| 169 | Ga0466731_005818 | 3300042622 | Bacteria | 3279 |
| 170 | Ga0466702_151796 | 3300042635 | Bacteria | 28798 |
| 171 | Ga0466704_366737 | 3300042643 | Bacteria | 23340 |
| 172 | Ga0466708_019327 | 3300042652 | Bacteria | 13792 |
| 173 | Ga0466700_312508 | 3300042600 | Bacteria | 3032 |
| 174 | Ga0466720_044701 | 3300042607 | Bacteria | 20572 |
| 175 | Ga0466722_243367 | 3300042609 | Bacteria | 2682 |
| 176 | 2226986776 | 2225789003 | Bacteria | 1720 |
| 177 | IMNBL1DRAFT_c0000042 | 3300000062 | Bacteria | 116840 |
| 178 | IMNBL1DRAFT_c0000615 | 3300000062 | Bacteria | 28555 |
| 179 | AustNasuHG_c1001675 | 3300000089 | Bacteria | 7991 |
| 180 | JGI24698J34947_10000327 | 3300002449 | Bacteria | 21005 |
| 181 | JGI24695J34938_10000019 | 3300002450 | Bacteria | 113818 |
| 182 | JGI24695J34938_10000062 | 3300002450 | Bacteria | 88353 |
| 183 | JGI24695J34938_10000627 | 3300002450 | Bacteria | 33643 |
| 184 | JGI24695J34938_10013925 | 3300002450 | Bacteria | 4199 |
| 185 | JGI24695J34938_10015470 | 3300002450 | Bacteria | 3915 |
| 186 | JGI24695J34938_10025983 | 3300002450 | Bacteria | 2789 |
| 187 | Ga0123357_10358443 | 3300009784 | Bacteria | 1384 |
| 188 | Ga0123355_10163621 | 3300009826 | Bacteria | 3345 |
| 189 | Ga0123356_10000326 | 3300010049 | Bacteria | 54830 |
| 190 | Ga0123356_10005905 | 3300010049 | Bacteria | 12424 |
| 191 | Ga0123356_10053567 | 3300010049 | Bacteria | 3756 |
| 192 | Ga0123356_10430973 | 3300010049 | Bacteria | 1463 |
| 193 | Ga0123353_10027995 | 3300010167 | Bacteria | 8647 |
| 194 | Ga0466710_290726 | 3300042613 | Bacteria | 60149 |
| 195 | Ga0466712_021690 | 3300042614 | Bacteria | 45968 |
| 196 | Ga0466715_162149 | 3300042616 | Bacteria | 28789 |
| 197 | Ga0466718_035212 | 3300042617 | Bacteria | 6168 |
| 198 | Ga0466732_220650 | 3300042656 | Bacteria | 1500 |
| 199 | Ga0160444_103283 | 3300012841 | Bacteria | 2338 |
| 200 | Ga0415639_007040 | 3300038395 | Bacteria | 18589 |
| 201 | Ga0466692_151109 | 3300042591 | Bacteria | 5703 |
| 202 | Ga0466694_079548 | 3300042594 | Bacteria | 3725 |
| 203 | Ga0466699_076803 | 3300042597 | Bacteria | 2018 |
| 204 | Ga0466699_216931 | 3300042597 | Bacteria | 12520 |
| 205 | Ga0466735_017858 | 3300042624 | Bacteria | 100811 |
| 206 | Ga0466702_238237 | 3300042635 | Bacteria | 2453 |
| 207 | Ga0466702_269454 | 3300042635 | Bacteria | 2075 |
| 208 | Ga0466702_291656 | 3300042635 | Bacteria | 6277 |
| 209 | Ga0466702_423777 | 3300042635 | Bacteria | 6458 |
| 210 | Ga0466708_368772 | 3300042652 | Bacteria | 50694 |
| 211 | Ga0466700_098939 | 3300042600 | Bacteria | 2155 |
| 212 | Ga0466716_376102 | 3300042605 | Bacteria | 1566 |
| 213 | Ga0466720_145657 | 3300042607 | Bacteria | 7232 |
| 214 | Ga0466720_161643 | 3300042607 | Bacteria | 5623 |
| 215 | 2227535725 | 2225789004 | Bacteria | 57920 |
| 216 | IMNBL1DRAFT_c0000102 | 3300000062 | Bacteria | 74795 |
| 217 | IMNBL1DRAFT_c0003314 | 3300000062 | Bacteria | 10456 |
| 218 | JGI24695J34938_10002192 | 3300002450 | Bacteria | 15232 |
| 219 | JGI24695J34938_10028085 | 3300002450 | Bacteria | 2648 |
| 220 | JGI24695J34938_10042713 | 3300002450 | Bacteria | 2026 |
| 221 | Ga0074263_111062 | 3300005485 | Unclassified | 1542 |
| 222 | Ga0123356_10163900 | 3300010049 | Bacteria | 2224 |
| 223 | Ga0123353_10353164 | 3300010167 | Bacteria | 2214 |
| 224 | Ga0466712_043152 | 3300042614 | Bacteria | 8951 |
| 225 | Ga0466711_229001 | 3300042615 | Bacteria | 8051 |
| 226 | Ga0466711_418222 | 3300042615 | Bacteria | 19914 |
| 227 | Ga0466718_027489 | 3300042617 | Bacteria | 4032 |
| 228 | Ga0466718_035713 | 3300042617 | Bacteria | 12186 |
| 229 | Ga0466718_110619 | 3300042617 | Bacteria | 29824 |
| 230 | Ga0466726_289185 | 3300042619 | Bacteria | 3707 |
| 231 | Ga0466732_223587 | 3300042656 | Bacteria | 2554 |
| 232 | Ga0415639_111950 | 3300038395 | Unclassified | 3995 |
| 233 | Ga0456237_0003537 | 3300041968 | Unclassified | 2528 |
| 234 | Ga0466693_193542 | 3300042592 | Bacteria | 34341 |
| 235 | Ga0466694_380868 | 3300042594 | Bacteria | 1369 |
| 236 | Ga0466699_102971 | 3300042597 | Bacteria | 28430 |
| 237 | Ga0466699_126936 | 3300042597 | Bacteria | 1272 |
| 238 | Ga0466699_189498 | 3300042597 | Bacteria | 26474 |
| 239 | Ga0466699_260281 | 3300042597 | Bacteria | 5354 |
| 240 | Ga0466699_315957 | 3300042597 | Bacteria | 24467 |
| 241 | Ga0466699_352844 | 3300042597 | Bacteria | 5948 |
| 242 | Ga0466699_424309 | 3300042597 | Bacteria | 11276 |
| 243 | Ga0466731_207826 | 3300042622 | Bacteria | 1716 |
| 244 | Ga0466708_159161 | 3300042652 | Unclassified | 1389 |
| 245 | Ga0466706_078649 | 3300042599 | Bacteria | 63991 |
| 246 | Ga0466713_072870 | 3300042602 | Unclassified | 32371 |
| 247 | Ga0466713_141984 | 3300042602 | Bacteria | 5868 |
| 248 | Ga0466720_044105 | 3300042607 | Bacteria | 31294 |
| 249 | Ga0466720_046088 | 3300042607 | Bacteria | 7316 |
| 250 | Ga0466720_166274 | 3300042607 | Bacteria | 16068 |
| 251 | IMNBL1DRAFT_c0017382 | 3300000062 | Bacteria | 3028 |
| 252 | JGI24698J34947_10003657 | 3300002449 | Bacteria | 8347 |
| 253 | JGI24698J34947_10012096 | 3300002449 | Unclassified | 4736 |
| 254 | JGI24698J34947_10046141 | 3300002449 | Unclassified | 2219 |
| 255 | JGI24697J35500_11263019 | 3300002507 | Bacteria | 3177 |
| 256 | Ga0072941_1024684 | 3300005201 | Bacteria | 4534 |
| 257 | Ga0074263_100437 | 3300005485 | Bacteria | 2604 |
| 258 | Ga0123356_10000482 | 3300010049 | Bacteria | 44631 |
| 259 | Ga0123356_10003085 | 3300010049 | Bacteria | 17599 |
| 260 | Ga0123356_10570083 | 3300010049 | Bacteria | 1295 |
| 261 | Ga0123353_10476762 | 3300010167 | Bacteria | 1827 |
| 262 | Ga0466712_098981 | 3300042614 | Bacteria | 3610 |
| 263 | Ga0466718_012073 | 3300042617 | Bacteria | 1515 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.