Protein Family IF06864
Metagenome
Isolate
292
Members
97
Samples
257
Scaffolds
317.22
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_182453|Ga0466722_182453_507_1685
- Length
- 392 aa
- Sequence
- LRPPRIKKERNLFAPAAALSSGRHSRGIARNVPAVYFSPASRHLPWIAFLYILYLFVHNWRFYLIFASNNHLRNTTVDISIVIPLLNEAESLPELHEWIQRVMEREKFSYEIIFVDDGSTDHSWEIIKRLHQKHPEIRAIRFQRNYGKSPALNTAFRKTRGDVVITMDADLQDNPDEIPELYRMIKEENYQLVSGWKKKRYDPISKTLPTKLFNATARTFSGIKLHDFNCGLKAYNKEVVKNIEIYNDMHRWIPFLAKNAGFARIGEKVVQHQTRKYGHTKFGLDRFANGYLDLFTLWFLSKFGKKPMHFFGLIGSLMFVIGVMAVLVVGGMKAWALYKGFTAPLVTNIPYFYIAITCMIIGTQLFLAGFIGELISRNAPDRNQYDVVEELE
Sample Types
Isolate
12.0%
Metagenome
88.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.1%
Blattidae
18.8%
Kalotermitidae
14.6%
Unclassified
13.5%
Rhinotermitidae
5.2%
Drosophilidae
4.2%
Termopsidae
4.2%
Formicidae
2.1%
Tenebrionidae
2.1%
Hydrophilidae
2.1%
Passalidae
2.1%
Hodotermitidae
1.0%
Apidae
1.0%
Elmidae
1.0%
Taxonomy
Archaea
0
Bacteria
283
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 2 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 3 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 4 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 5 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 6 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 7 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 8 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 9 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 10 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 16 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 17 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 26 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 27 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 30 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 31 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 32 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 33 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 34 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 35 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 36 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 37 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 38 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 39 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 44 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 45 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 46 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 47 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 48 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 49 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 50 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 51 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 52 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 53 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 54 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 55 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 56 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 57 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 58 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 59 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 62 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 65 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 66 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 67 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 68 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 69 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 70 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 72 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 73 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 74 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 75 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 76 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 77 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 78 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 79 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 80 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 81 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 82 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 83 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 84 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 85 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 86 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 87 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 88 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 89 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 90 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 91 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 92 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 93 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 94 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 95 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 96 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 97 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466657_012351 | 3300042582 | Bacteria | 8428 |
| 2 | Ga0466657_276834 | 3300042582 | Bacteria | 73640 |
| 3 | Ga0466690_260239 | 3300042590 | Bacteria | 21247 |
| 4 | Ga0466690_402774 | 3300042590 | Bacteria | 11069 |
| 5 | Ga0466692_072678 | 3300042591 | Bacteria | 13508 |
| 6 | Ga0466696_108775 | 3300042596 | Bacteria | 27757 |
| 7 | Ga0466700_268423 | 3300042600 | Bacteria | 20138 |
| 8 | Ga0466697_027951 | 3300042611 | Bacteria | 74281 |
| 9 | Ga0123353_10000048 | 3300010167 | Bacteria | 132187 |
| 10 | Ga0123353_10048032 | 3300010167 | Bacteria | 6793 |
| 11 | Ga0123353_10066810 | 3300010167 | Bacteria | 5773 |
| 12 | Ga0123354_10003756 | 3300010882 | Bacteria | 21142 |
| 13 | Ga0123354_10034370 | 3300010882 | Bacteria | 7928 |
| 14 | Ga0466715_160020 | 3300042616 | Bacteria | 7262 |
| 15 | Ga0466734_017669 | 3300042623 | Bacteria | 6868 |
| 16 | Ga0466704_251283 | 3300042643 | Bacteria | 8324 |
| 17 | Ga0466704_429736 | 3300042643 | Bacteria | 8589 |
| 18 | Ga0466704_441051 | 3300042643 | Bacteria | 21271 |
| 19 | Ga0466709_309159 | 3300042648 | Bacteria | 10680 |
| 20 | IMNBL1DRAFT_c0000997 | 3300000062 | Bacteria | 21827 |
| 21 | Ga0068305_10027932 | 3300005083 | Unclassified | 9466 |
| 22 | Ga0068305_10033366 | 3300005083 | Bacteria | 9897 |
| 23 | Ga0466697_124631 | 3300042611 | Bacteria | 1732 |
| 24 | Ga0466690_026402 | 3300042590 | Bacteria | 15626 |
| 25 | Ga0466690_269123 | 3300042590 | Bacteria | 14586 |
| 26 | Ga0466696_127307 | 3300042596 | Bacteria | 1501 |
| 27 | Ga0466713_071707 | 3300042602 | Bacteria | 2663 |
| 28 | Ga0466713_096127 | 3300042602 | Bacteria | 27741 |
| 29 | Ga0466719_106322 | 3300042606 | Bacteria | 7666 |
| 30 | Ga0466719_182249 | 3300042606 | Bacteria | 5562 |
| 31 | Ga0123354_10018734 | 3300010882 | Bacteria | 10864 |
| 32 | Ga0466711_057584 | 3300042615 | Bacteria | 4340 |
| 33 | Ga0466715_026255 | 3300042616 | Bacteria | 31429 |
| 34 | Ga0466715_108382 | 3300042616 | Bacteria | 12011 |
| 35 | Ga0466718_144933 | 3300042617 | Bacteria | 1507 |
| 36 | Ga0466703_118101 | 3300042636 | Bacteria | 3014 |
| 37 | Ga0466703_211177 | 3300042636 | Bacteria | 9779 |
| 38 | Ga0466703_212776 | 3300042636 | Bacteria | 3482 |
| 39 | Ga0466703_331928 | 3300042636 | Bacteria | 15818 |
| 40 | Ga0466709_325692 | 3300042648 | Bacteria | 4849 |
| 41 | IMNBL1DRAFT_c0021206 | 3300000062 | Bacteria | 2607 |
| 42 | JGI24702J35022_10016052 | 3300002462 | Bacteria | 4110 |
| 43 | JGI24702J35022_10060098 | 3300002462 | Bacteria | 2031 |
| 44 | Ga0104048_1006256 | 3300007143 | Unclassified | 10380 |
| 45 | Ga0104019_1030522 | 3300007150 | Unclassified | 6352 |
| 46 | Ga0466656_224076 | 3300042550 | Bacteria | 24068 |
| 47 | Ga0466657_080752 | 3300042582 | Bacteria | 7197 |
| 48 | Ga0466690_013407 | 3300042590 | Bacteria | 18918 |
| 49 | Ga0466692_115934 | 3300042591 | Bacteria | 12711 |
| 50 | Ga0466692_129541 | 3300042591 | Bacteria | 3818 |
| 51 | Ga0466691_089012 | 3300042593 | Bacteria | 15745 |
| 52 | Ga0466701_011470 | 3300042598 | Bacteria | 1529 |
| 53 | Ga0466701_019932 | 3300042598 | Bacteria | 51949 |
| 54 | Ga0466700_040833 | 3300042600 | Bacteria | 26280 |
| 55 | Ga0466707_027830 | 3300042601 | Bacteria | 8324 |
| 56 | Ga0466713_059017 | 3300042602 | Bacteria | 26100 |
| 57 | Ga0466713_084269 | 3300042602 | Bacteria | 58503 |
| 58 | Ga0466713_104125 | 3300042602 | Bacteria | 8031 |
| 59 | Ga0466719_330700 | 3300042606 | Bacteria | 1038 |
| 60 | Ga0123357_10004022 | 3300009784 | Bacteria | 17106 |
| 61 | Ga0123353_10917552 | 3300010167 | Bacteria | 1190 |
| 62 | Ga0466715_018780 | 3300042616 | Bacteria | 3486 |
| 63 | Ga0466715_143392 | 3300042616 | Bacteria | 8322 |
| 64 | Ga0466723_182800 | 3300042618 | Bacteria | 17816 |
| 65 | Ga0466728_477990 | 3300042620 | Bacteria | 1959 |
| 66 | Ga0466734_149312 | 3300042623 | Bacteria | 1936 |
| 67 | Ga0466703_218033 | 3300042636 | Bacteria | 11419 |
| 68 | Ga0466704_088141 | 3300042643 | Bacteria | 5939 |
| 69 | Ga0466727_170943 | 3300042655 | Bacteria | 36421 |
| 70 | Ga0466727_171718 | 3300042655 | Bacteria | 3547 |
| 71 | Ga0466727_193642 | 3300042655 | Bacteria | 6211 |
| 72 | Ga0466727_279119 | 3300042655 | Bacteria | 2937 |
| 73 | JGI24699J35502_11133985 | 3300002509 | Bacteria | 22789 |
| 74 | JGI24696J40584_12878115 | 3300002834 | Bacteria | 1073 |
| 75 | Ga0466705_037151 | 3300042612 | Bacteria | 38711 |
| 76 | Ga0466705_101884 | 3300042612 | Bacteria | 4092 |
| 77 | Ga0466705_146008 | 3300042612 | Bacteria | 2426 |
| 78 | Ga0466733_037271 | 3300042659 | Bacteria | 8714 |
| 79 | Ga0466733_092790 | 3300042659 | Bacteria | 4200 |
| 80 | Ga0456237_0000002 | 3300041968 | Bacteria | 104267 |
| 81 | Ga0466690_332773 | 3300042590 | Bacteria | 19205 |
| 82 | Ga0466692_175737 | 3300042591 | Bacteria | 5368 |
| 83 | Ga0466692_179942 | 3300042591 | Bacteria | 100786 |
| 84 | Ga0466694_405291 | 3300042594 | Bacteria | 10333 |
| 85 | Ga0466696_012684 | 3300042596 | Bacteria | 7511 |
| 86 | Ga0466706_054670 | 3300042599 | Bacteria | 52813 |
| 87 | Ga0466713_001811 | 3300042602 | Bacteria | 11229 |
| 88 | Ga0466713_036697 | 3300042602 | Bacteria | 37630 |
| 89 | Ga0466716_445473 | 3300042605 | Bacteria | 2862 |
| 90 | Ga0466722_113574 | 3300042609 | Bacteria | 2622 |
| 91 | Ga0466722_182453 | 3300042609 | Bacteria | 2254 |
| 92 | Ga0466722_224406 | 3300042609 | Bacteria | 14744 |
| 93 | Ga0123355_10000074 | 3300009826 | Bacteria | 105380 |
| 94 | Ga0123356_10297746 | 3300010049 | Bacteria | 1717 |
| 95 | Ga0123353_10585304 | 3300010167 | Bacteria | 1600 |
| 96 | Ga0123354_10161316 | 3300010882 | Bacteria | 2660 |
| 97 | Ga0123354_10224817 | 3300010882 | Bacteria | 1982 |
| 98 | Ga0466711_063250 | 3300042615 | Bacteria | 6541 |
| 99 | Ga0466711_200885 | 3300042615 | Bacteria | 12426 |
| 100 | Ga0466715_103901 | 3300042616 | Bacteria | 35101 |
| 101 | Ga0466715_329130 | 3300042616 | Bacteria | 55839 |
| 102 | Ga0466729_100069 | 3300042621 | Bacteria | 3159 |
| 103 | Ga0466704_077262 | 3300042643 | Bacteria | 1881 |
| 104 | Ga0466704_244177 | 3300042643 | Unclassified | 3473 |
| 105 | Ga0466704_252227 | 3300042643 | Bacteria | 7578 |
| 106 | Ga0466708_206304 | 3300042652 | Bacteria | 6321 |
| 107 | Ga0466727_316358 | 3300042655 | Unclassified | 1256 |
| 108 | JGI24702J35022_10066263 | 3300002462 | Unclassified | 1938 |
| 109 | JGI24699J35502_11134134 | 3300002509 | Bacteria | 35214 |
| 110 | Ga0068305_10473371 | 3300005083 | Unclassified | 2161 |
| 111 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 112 | Ga0466690_180504 | 3300042590 | Bacteria | 4555 |
| 113 | Ga0466692_113597 | 3300042591 | Bacteria | 4143 |
| 114 | Ga0466695_090612 | 3300042595 | Bacteria | 4718 |
| 115 | Ga0466706_202395 | 3300042599 | Bacteria | 2033 |
| 116 | Ga0466713_070338 | 3300042602 | Bacteria | 49717 |
| 117 | Ga0466716_103571 | 3300042605 | Bacteria | 8889 |
| 118 | Ga0466716_313330 | 3300042605 | Bacteria | 4501 |
| 119 | Ga0466719_470213 | 3300042606 | Bacteria | 2573 |
| 120 | Ga0466721_081606 | 3300042608 | Bacteria | 8695 |
| 121 | Ga0466722_232470 | 3300042609 | Bacteria | 73289 |
| 122 | Ga0123357_10068634 | 3300009784 | Bacteria | 4717 |
| 123 | Ga0123354_10052732 | 3300010882 | Bacteria | 6124 |
| 124 | Ga0123354_10115811 | 3300010882 | Bacteria | 3501 |
| 125 | Ga0123354_10125012 | 3300010882 | Bacteria | 3291 |
| 126 | Ga0466712_118515 | 3300042614 | Bacteria | 1371 |
| 127 | Ga0466711_047945 | 3300042615 | Bacteria | 4999 |
| 128 | Ga0466711_287998 | 3300042615 | Bacteria | 12631 |
| 129 | Ga0466715_057287 | 3300042616 | Bacteria | 64422 |
| 130 | Ga0466715_464049 | 3300042616 | Bacteria | 2434 |
| 131 | Ga0466723_119120 | 3300042618 | Bacteria | 10641 |
| 132 | Ga0466726_285053 | 3300042619 | Bacteria | 3552 |
| 133 | Ga0466726_427060 | 3300042619 | Bacteria | 1629 |
| 134 | Ga0466735_055482 | 3300042624 | Bacteria | 3852 |
| 135 | Ga0466703_198168 | 3300042636 | Bacteria | 7558 |
| 136 | Ga0466704_015631 | 3300042643 | Bacteria | 3512 |
| 137 | Ga0466704_191274 | 3300042643 | Bacteria | 4869 |
| 138 | Ga0466704_301653 | 3300042643 | Bacteria | 9508 |
| 139 | Ga0466704_522102 | 3300042643 | Bacteria | 3523 |
| 140 | Ga0466709_358536 | 3300042648 | Bacteria | 3181 |
| 141 | Ga0466708_190978 | 3300042652 | Bacteria | 28398 |
| 142 | Ga0466727_298052 | 3300042655 | Bacteria | 8910 |
| 143 | JGI24702J35022_10003594 | 3300002462 | Bacteria | 9331 |
| 144 | JGI24702J35022_10021068 | 3300002462 | Bacteria | 3538 |
| 145 | JGI24699J35502_11134111 | 3300002509 | Bacteria | 32127 |
| 146 | Ga0068302_10067783 | 3300005071 | Bacteria | 4042 |
| 147 | Ga0104045_1000496 | 3300007085 | Bacteria | 6377 |
| 148 | Ga0104050_1200303 | 3300007153 | Bacteria | 2449 |
| 149 | Ga0103268_1000065 | 3300007192 | Bacteria | 32033 |
| 150 | Ga0466705_344224 | 3300042612 | Bacteria | 18559 |
| 151 | Ga0466690_388851 | 3300042590 | Bacteria | 15302 |
| 152 | Ga0466692_119633 | 3300042591 | Bacteria | 108688 |
| 153 | Ga0466691_154445 | 3300042593 | Bacteria | 2676 |
| 154 | Ga0466691_205215 | 3300042593 | Bacteria | 7142 |
| 155 | Ga0466701_064830 | 3300042598 | Bacteria | 186218 |
| 156 | Ga0466707_384697 | 3300042601 | Bacteria | 7885 |
| 157 | Ga0466713_119471 | 3300042602 | Bacteria | 17749 |
| 158 | Ga0466717_124809 | 3300042604 | Bacteria | 2538 |
| 159 | Ga0466716_163384 | 3300042605 | Bacteria | 16200 |
| 160 | Ga0466722_162030 | 3300042609 | Bacteria | 5919 |
| 161 | Ga0123355_10003374 | 3300009826 | Bacteria | 22877 |
| 162 | Ga0123353_10010277 | 3300010167 | Bacteria | 13026 |
| 163 | Ga0123353_10018267 | 3300010167 | Bacteria | 10360 |
| 164 | Ga0123353_10582172 | 3300010167 | Bacteria | 1605 |
| 165 | Ga0123354_10000089 | 3300010882 | Bacteria | 67418 |
| 166 | Ga0123354_10138822 | 3300010882 | Bacteria | 3021 |
| 167 | Ga0466710_155280 | 3300042613 | Bacteria | 1961 |
| 168 | Ga0466711_160184 | 3300042615 | Bacteria | 13975 |
| 169 | Ga0466711_197673 | 3300042615 | Bacteria | 1967 |
| 170 | Ga0466723_302805 | 3300042618 | Bacteria | 3005 |
| 171 | Ga0466735_066948 | 3300042624 | Bacteria | 3154 |
| 172 | Ga0466703_020181 | 3300042636 | Bacteria | 3099 |
| 173 | Ga0466703_197122 | 3300042636 | Bacteria | 11485 |
| 174 | Ga0466703_222482 | 3300042636 | Bacteria | 4165 |
| 175 | Ga0466703_340861 | 3300042636 | Bacteria | 1427 |
| 176 | Ga0466704_104502 | 3300042643 | Bacteria | 10368 |
| 177 | Ga0466704_293666 | 3300042643 | Bacteria | 4044 |
| 178 | Ga0466704_495117 | 3300042643 | Bacteria | 22983 |
| 179 | Ga0466709_219154 | 3300042648 | Bacteria | 176728 |
| 180 | JGI24702J35022_10007040 | 3300002462 | Bacteria | 6460 |
| 181 | JGI24702J35022_10037776 | 3300002462 | Bacteria | 2579 |
| 182 | Ga0068305_10051920 | 3300005083 | Bacteria | 15549 |
| 183 | Ga0104048_1002169 | 3300007143 | Bacteria | 4136 |
| 184 | Ga0103267_1000034 | 3300007190 | Bacteria | 93479 |
| 185 | Ga0103267_1000045 | 3300007190 | Bacteria | 74090 |
| 186 | Ga0123357_10002196 | 3300009784 | Bacteria | 21547 |
| 187 | Ga0466733_183993 | 3300042659 | Bacteria | 3833 |
| 188 | Ga0466733_186141 | 3300042659 | Bacteria | 8487 |
| 189 | Ga0466656_245797 | 3300042550 | Bacteria | 2336 |
| 190 | Ga0466690_426281 | 3300042590 | Bacteria | 1955 |
| 191 | Ga0466700_437693 | 3300042600 | Bacteria | 1309 |
| 192 | Ga0466707_127369 | 3300042601 | Bacteria | 23245 |
| 193 | Ga0466707_207014 | 3300042601 | Bacteria | 8565 |
| 194 | Ga0466713_039979 | 3300042602 | Bacteria | 6886 |
| 195 | Ga0466716_242397 | 3300042605 | Bacteria | 12768 |
| 196 | Ga0466719_508543 | 3300042606 | Bacteria | 4973 |
| 197 | Ga0466722_089680 | 3300042609 | Bacteria | 3275 |
| 198 | Ga0466710_413748 | 3300042613 | Bacteria | 2120 |
| 199 | Ga0466711_099584 | 3300042615 | Bacteria | 34400 |
| 200 | Ga0466711_250127 | 3300042615 | Bacteria | 4275 |
| 201 | Ga0466715_288497 | 3300042616 | Bacteria | 3017 |
| 202 | Ga0466723_017153 | 3300042618 | Bacteria | 10507 |
| 203 | Ga0466723_042543 | 3300042618 | Bacteria | 7766 |
| 204 | Ga0466726_261838 | 3300042619 | Bacteria | 3573 |
| 205 | Ga0466729_039783 | 3300042621 | Bacteria | 11260 |
| 206 | Ga0466729_292479 | 3300042621 | Bacteria | 37992 |
| 207 | Ga0466735_024490 | 3300042624 | Bacteria | 16233 |
| 208 | Ga0466735_118048 | 3300042624 | Bacteria | 2728 |
| 209 | Ga0466735_169577 | 3300042624 | Bacteria | 6040 |
| 210 | Ga0466703_212754 | 3300042636 | Bacteria | 16986 |
| 211 | Ga0466704_058804 | 3300042643 | Bacteria | 8666 |
| 212 | Ga0466704_112671 | 3300042643 | Bacteria | 16257 |
| 213 | Ga0466709_302058 | 3300042648 | Bacteria | 17795 |
| 214 | Ga0466724_52468 | 3300042649 | Bacteria | 7120 |
| 215 | 2227516603 | 2225789004 | Bacteria | 3429 |
| 216 | IMNBL1DRAFT_c0000402 | 3300000062 | Bacteria | 36892 |
| 217 | Ga0103267_1000265 | 3300007190 | Bacteria | 19576 |
| 218 | Ga0466697_093951 | 3300042611 | Bacteria | 1287 |
| 219 | Ga0466732_193835 | 3300042656 | Bacteria | 6511 |
| 220 | Ga0466733_049929 | 3300042659 | Bacteria | 1537 |
| 221 | Ga0466733_106246 | 3300042659 | Bacteria | 308825 |
| 222 | Ga0466692_008187 | 3300042591 | Bacteria | 121981 |
| 223 | Ga0466693_164146 | 3300042592 | Bacteria | 1205 |
| 224 | Ga0466691_049581 | 3300042593 | Bacteria | 44383 |
| 225 | Ga0466701_009251 | 3300042598 | Bacteria | 15413 |
| 226 | Ga0466707_048296 | 3300042601 | Bacteria | 2688 |
| 227 | Ga0466707_191075 | 3300042601 | Bacteria | 6512 |
| 228 | Ga0466707_284004 | 3300042601 | Bacteria | 2175 |
| 229 | Ga0466713_075890 | 3300042602 | Bacteria | 10219 |
| 230 | Ga0466713_095591 | 3300042602 | Bacteria | 21748 |
| 231 | Ga0466714_115350 | 3300042603 | Bacteria | 92077 |
| 232 | Ga0466716_106488 | 3300042605 | Bacteria | 9087 |
| 233 | Ga0466716_304356 | 3300042605 | Bacteria | 13356 |
| 234 | Ga0466716_504177 | 3300042605 | Bacteria | 2080 |
| 235 | Ga0466722_048054 | 3300042609 | Bacteria | 48867 |
| 236 | Ga0466722_103167 | 3300042609 | Bacteria | 6943 |
| 237 | Ga0466722_201679 | 3300042609 | Bacteria | 3354 |
| 238 | Ga0123353_10117480 | 3300010167 | Bacteria | 4278 |
| 239 | Ga0466705_470612 | 3300042612 | Unclassified | 1693 |
| 240 | Ga0466705_489386 | 3300042612 | Bacteria | 1567 |
| 241 | Ga0466710_118796 | 3300042613 | Bacteria | 24951 |
| 242 | Ga0466711_058896 | 3300042615 | Bacteria | 7461 |
| 243 | Ga0466711_359387 | 3300042615 | Bacteria | 8116 |
| 244 | Ga0466715_291178 | 3300042616 | Bacteria | 18028 |
| 245 | Ga0466723_065546 | 3300042618 | Bacteria | 7651 |
| 246 | Ga0466726_069435 | 3300042619 | Bacteria | 20489 |
| 247 | Ga0466726_489400 | 3300042619 | Bacteria | 26038 |
| 248 | Ga0466728_343910 | 3300042620 | Unclassified | 18970 |
| 249 | Ga0466728_440984 | 3300042620 | Bacteria | 2460 |
| 250 | Ga0466735_215945 | 3300042624 | Bacteria | 1432 |
| 251 | Ga0466703_400896 | 3300042636 | Bacteria | 22375 |
| 252 | Ga0466704_236307 | 3300042643 | Bacteria | 2259 |
| 253 | Ga0466708_049480 | 3300042652 | Bacteria | 9368 |
| 254 | Ga0466725_436649 | 3300042654 | Bacteria | 19499 |
| 255 | Ga0466727_154170 | 3300042655 | Bacteria | 16864 |
| 256 | IMNBL1DRAFT_c0009095 | 3300000062 | Bacteria | 4967 |
| 257 | Ga0123357_10001046 | 3300009784 | Bacteria | 28431 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.